Poverty Alleviation Programmes Under The Plans
Veda and Bharat
The Japu Ji Sahib
Shahjahan's Delhi Past and Present
Empowerment of Women in India 1st Edition
Health and Family Welfare Public Policy and People's Participation in India 1st
Researches in Archaeological and Conservation 1st Edition
Human Rights in Pre-Trial Detention
Children's Libraries
South Indian Archaeology 1st Edition
Organised Transnational Crimes
My City was Gone One American Town's Toxic Secret, its Angry Band of Locals and a $
C.S. Lewis A Complete Guide to His Life & Works
The Screwtape Letters With Screwtape Proposes a Toast
The Disinherited Exile and the Making of Spanish Culture, 1492-1975
Peaches
A Personal Matter
Island Girls (and Boys) 1st Avon Edition
The Wish (rack)
Lying in Weight The Hidden Epidemic of Eating Disorders in Adult Women 1st Edition
Shuffle Up and Deal The Ultimate No Limit Texas Hold em Guide
The Body in the Gallery A Faith Fairchild Mystery
The Patricia Cornwell CD Audio Treasury Low Price Contains all that Remains and Cruel and Unusual
Spice Flavors of the Eastern Mediterranean
Im Sorry
Overcoming Underearning A Five-Step Plan to a Richer Life
The Color of Blood
A Short History of the United States
Hating Women America's Hostile Campaign Against the Fairer Sex
Shattered Silk
Back to the Bedroom LP
The Wit & Wisdom of Winston Churchill
Love, Again
The Name of the World A Novel
Resurrecting Sex Solving Sexual Problems and Revolutionizing Your Relationship
Ghosts of Manila The Fateful Blood Feud Between Muhammad Ali and Joe Frazier
Giant
Kobe The Story of the NBA's Rising Young St
Poppy and Ereth
Just Wicked Enough
The Dance of the Dissident Daughter A Woman&
The Reptile Room Or, Murder!
Identity by Design Tradition, Change, and Celebration in Native Women&am
Avalon High: Coronation No.3 Hunter&
Distant Heart
Twenty Years Crisis, 1919-1939
Guide to Toy Collecting
The Glory Days New York Baseball
Real Live Boyfriends: Yes. Boyfriends, plural. If my life werent complicated, I wouldnt be Ruby O
Red Glass
The Memories: JFK 1961-1963
The Perfect Storm A True Story of Men Against the Sea
Deep Survival Who Lives, who Dies, and why
Making Globalization Work
The Seminar of Jacques Lacan, Book 17 The other Side of Psychoanalysis
The Return of Depression Economics and the Crisis of 2008
The American
Newtonian Mechanics
Facing Shame: Families in Recovery
Everybody Says Freedom: A History of the Civil Rights Movement in Songs and Pictures
Post Captain
The House by the Sea A Journal
Michaelangelo: The Sistine Chapel Ceiling (Norton Critical Studies in Art History)
The Commodore
Lost Opportunity What Has Made Economic Reform in Russia So Difficult?
The Impeachment and Trial of Andrew Johnson
Yellow: Stories
The Annotated Hans Christian Andersen (The Annotated Books)
The Annotated Wind in the Willows (The Annotated Books)
3 Willows The Sisterhood Grows
Going Bovine
Micro A Novel
From Resistance to Revolution Colonial Radicals and the Development of American Opposition to Brita
Understanding Ambedkar 1st Edition
India A Reference Annual - 1999
John Rawls Concept of Justice Rawat Ideas & Thinkers in Social Science
Acrylics in 10 Steps
Asterix Omnibus 3, Asterix and the Big Fight, Asterix in Britain and Asterix and the Normans 3 Vols.
Blackveil
Labels
The Reading Promise 3,218 Nights Of Reading With My Father
Kingfisher Readers Where Animals Live
Welcome to Friendship A Course That Empowers Young People to Discover the Need For and Value of Pos
Battling the Hamster Wheel (TM) Strategies for Making High School Reform Work
What Every Principal Should Know About Operational Leadership
A Federal Offense A Novel
Answers A User's Guide to Retirement
Seven Out
The Cat Arches Her Back
Woman Vanishes
"The Internet Hero Darc Fyber is the iHero&
Something at The Center
Christmas Stories from the Jersey Cape
Lord Given Lovers The Holy Union of David & Jonathan
Inside the Sun Journey through the Heart of Your Nearest Star
Dana Dale's Diary A Year in the Life of an Oversexed British Housewife
Audio Cassette Odyssey's The Curse of the Goblin King
The Same Only Different
Family of Angels
The Case of the Missing Mogul A Reminiscence of Dr. Jarvis Weston, M.D
The Meister's Approach to Writing
The Dance The Sequel to Allegiance
Can You Hear the Music?
Dragon and the Rose, Part 2 The Confrontation
Memoirs of a Survivor of the Twentieth Century From Transylvania to the United States
A Deliberate Life A Journey into the Alaskan Wilderness
Instincts The Hidden Spirits That Drive You
The Electronic Prophet A Novel
Charlotte's Tree
Going Down
Keys to Becoming a Virtuous Woman
The Black Messiah Murders, No. 1 A Sam Cohen Case Adventure
Gravity Decoded Exploring the Structure of Space-Energy
Ready the Eight
The Cannae Sutra The Scots Joy of Sex!
Healthy Church Dna® Transforming the Church for Effective Ministry
Discover the Secret of True Love
The Accidental Agent
Searching for Love A Semi Comedic Autobiographical Account
A Romance of Coca Or the Secret of a Villa A Novel
666 A Novel
D.N.A.
The Food of God, Vol. # 1 Spiritual Foods for Spiritual Breakthroughs
Angels, Show Me the Way Tools for Your Healing Journey
Eastern Wisdom Helps Enterprise The True Story of a Successful Entrepreneur
The Bridge to I Am Rapid Advance Psychotherapy
Sex and Sensuality Essays On Fun Stuff
Parent's Survival Guide to Maths Homewo
Lippincott's Illustrated Reviews Neuroscience
Gigantic Lengths and Other Vast Megastructures
Great Christian Thinkers From the Early Church Through the Middle Ages
Star Brands 2011 India's Most Impactful Brands
Faithful Unto Death
Schooling for Social Change The Rise and Impact of Human Rights Education in India
A Bloomsbury Iconography 1st Edition
Whitman's Queer Children America's Homosexual Epics 1st Edition
USAAF Aircraft Markings and Camouflage 1941-1947 The History of USAAF Aircraft Markings, Insignia, C
New Dynamics in East Asian Politics Security, Political Economy and Society
Fighter Units & Pilots of the 8th Air Force September 1942 - May
Fairy Dust & the Quest For the Egg
Explosive Sex !
Green Hornets The History of the U.S. Air Force 20th Special Operations Squadron
Trips in Time 1 - A Textbook for ICSE History and Civics
The Digested Read
Cambridge School Grammar 1
Education and Sports Psychology
Born to Win
The Mammoth Book of Prophecies The Predictions of Nostradamus and other Prophets, Visionaries and S
Introduction to SQL and PL/SQL
Enduring Faith the Promise Goes Unfulfilled Part 2
Soil Conservation and Organic Farming
Sustainable Development Administration An Analysis of Problems of Economy Environment and Equity
Nursing Diagnosis - Application to Clinical Practice
Firewall Architecture for the Enterprise
Death In The Stocks -Imp
C++ & Introduction to C#
Enzyme Induction- Mutagen Activation- and Carcinogen Testing in Yeast
How to Assure Quality in Plastics
The Yoga Bible
Thunder Over Kandahar
Animal Poster Book
Writing Thesis Format and Style for Physical Edu. and Sports Sc.
Computer Network
Basic Engineering for Medics and Biologists An ESEM Primer
Whats It Like to be an Ant?
Museum of Voices An Autobiographical Miscellany
Effective English A Boon for Learners
Constantine Versus the Bankers Military - Industrial - Church Complex, New World Order, Today&am
From Partying to Praying My Story, God's Glory
Dear Gang A Trek Through the Twentieth Century
Straight to the Point - Photoshop CS4
Pepper and the New Baby
Building Site
The Political Economy of Terrorism
Platonic Drama and its Ancient Reception
Natural History of Associations A Study in the Meaning of Community
Fundamentals of Numerical Weather Prediction
The Economics of Evaluation in Public Programs
Stories of Wisdom
The Wrong Messiah
Variational Problems in Differential Geometry
Behold the Eyes of An Eagle
Simply Fun Games Blister Books
Fun at the Beach Tom and Jerry (Story Book)
Satellite Meltdown
My Big Book of Sticker Colouring Fisher-Price (Colouring and Activity)
How to Plan Direct Mail
Tom & Jerry Black Paper Colouring Paper Colouring
My Big Book of Copy Colouring Bob the Builder (Colouring and Activity)
My Big Book of Sticker Colouring Bob the Builder (Colouring and Activity)
Sticker Copy Colouring Spongebob Squarepants (Colouring and Activity)
21st Century Geography A Reference Handbook 2 Vols.
It Happens only in India
Farm Birds First Puzzles
Mastering Maths Kindergarten
Time Tables Playmats
The Orchard Book of Grimm&am
Sea Animals Water Magic
Delhi the City of Monuments
Capitalism and Climate Change Theoretical Discussion, Historical Development and Policy Responses
Development in Developing Economies
Copy Colouring Tom and Jerry (Colouring and Activity Die Shaped)
ERC : Story of Doctor Dolittle Belly Ban
The Freud Files An Inquiry into the History of Psychoanalysis
First Objects Trace and Colour
365 Puzzles
Encyclopaedia of Physical Education, Sports and Exercise Science 4 Vols.
Reconstructing Earth's Climate History Inquiry-base
First Puzzles: Vegetables
E.X. Ferrars A Companion to the Mystery Fiction
Kangaroos My First Lessons Paper Models
Socio-Economic Profile of Rural India (Series II)
Biodiversity in Agriculture Domestication, Evolution, and Sustainability 1st Edition
Discrete Models of Financial Markets
Raman Spectroscopy and its Application in Nanostructures
Scientific Methods of Training and Coaching
Bihari Satsai A Commentary
The Best Way to Catch a Snake
Ethnobotony of the Kondh Poraja Gadaba and Bonda of the Koraput Region of Odisha India 1st Edition
Luxury Retail Management How the World&a
Women in Love
Progress in Food Preservation
New Lands within the Arctic Circle Narrative of the Discoveries of the Austrian Ship Tegetthoff in t
Discovering Chemistry with Natural Bond Orbitals
My Experiments with Truth (An Autobiography)
Linguistic Fieldwork A Student Guide
The Cambridge History of Religions in the Ancient World 2 Vols. 1st Edition
Textbook of Biochemistry for Dental Students
Learning English Book, 2
The Cambridge History of Musical Performance
Jamia Geographical Studies (A Collection of Geographical Essays) 1st Edition
Natural Disaster Women's Coping Strategy
Hearing Voices The Histories, Causes and Meanings of Auditory Verbal Hallucinations
Food for Thought [A Book of Inspiring Quotes]
I Can Make You Smarter
Marketing and Business Ethics
Hotel Organization and Management
Tales of a Midwife
The Church of England and Episcopacy
How to Borrow from Banking & Financial Institutions
Instructional Technology
Fauna Boreali-Americana, Vols. 2 The Birds, Containing Descriptions of the Objects of Natural Histor
Roothi Rani and Prema
Genetics and Heredity
Fisheries
Corporal Punishment of Children
Education, National Integration and Development
Food Microbiology
The New Business of Business Sharing Responsibility for a Positive Global Future
Trips in Time 2 Teachers Manual A Textbook for ICSE History and Civics
A Case-Based Approach to PET/CT in Oncology
The Golden Bough
Polymers for Electricity and Electronics Materials, Properties, and Applications
FlexRay and its Applications Real Time Multiplexed Network
An Account of the Basalts of Saxony With Observations on the Origin of Basalt in General
Ways of Social Change Making Sense of Modern Times
Greek Art and the Orient
Maqta : Ghalib on Ghalib [100 Signature Couplets of Mirza Asadullah Khan Ghalib] 1st Edition
A Small Circus
Great Ground Meat Recipes
Freedom, Vol. 2 A Documentary History of Emancipation, 18611867
Progress in Neurotherapeutics and Neuropsychopharmacology, Vol. 1, 2006
Travels in Crete
Kant Natural Science
The Cambridge Companion to Modern Indian Culture
Numerical Methods in Finance with C++
Quantum Information, Computation and Communication 1st Edition
Milton and the Art of Rhetoric
Genomics and Bioinformatics An Introduction to Programming Tools for Life Scientists
Performance in the Texts of Mallarm E The Passage from Art to Ritual
Beastly Things
The Future of Employment Relations
Wife Rape Understanding the Response of Survivors and Service Providers
The Principal's Guide to Raising Math Achievement
Teachings of Rumi
E-Resources for Teaching and Learning
Management and Policy Issues
Psychopathological Disorders Biopsychosocial Analysis
Solid and Hazardous Waste Management
Finding Peace of Mind
Understanding Plant Hormones
Counseling and Psychotherapy Theories in Context and Practice Study Guide 2nd Edition
People's Reactions to Technology In Factories, Offices, and Aerospa
Social Research in Communication and Law
Information Campaigns Balancing Social Values and Social Change
Qualitative Nursing Research A Contemporary Dialogue
Corporate Political Agency The Construction of Competition in Public Affairs
Mythic Monsters Revisited
The Responsibility to Protect Rhetoric, Reality and the Future of Humanitarian Intervention
Privitera, Statistics for the Behavioral Sciences + Study Guide + WebAssign [BUNDLE]
Typographia, or The Printers Instructor Including an Account of the Origin of Printing, with Biogr
Understanding Social Work Research 2nd Edition
Larger Than Life
English Ks1 6-7
No One Left to Tell
Social Research Survey and Statistics
Nuclear Accident
Electrical Science
Tribal Women in India
DIRECT Tax Laws Online [1886-2012] (With Weekly Internet Updation)
Johnson, Meeting the Ethical Challenges of Leadership, 4 Edition + SAGE, SAGE Brief Guide to Busine
Fuzzy Nation
Dictionary of Science (English-English-Hindi)
Formulae Mathematics, Vol. I
Encyclopaedia of Home Science
Text Book of Chemical Kinetics
West African Challenge to Empire Culture and History in the Volta-Bani Anticolonial War
Hour of the Wolf [Carambole]
Nigerian Video Films
Spindrift Stories from the U.S. Sea Services
All Gong and No Dinner 1001 Homely Phrases and Curious Domestic Sayings
Twelve Years with Hitler A History of 1.Kompanie Leibstandarte SS Adolf Hitler, 1933-45
Wisdom Roads Conversations with Remarkable Meditation
Bachem Ba 349 Natter
Life Our Century in Pictures for Young People
The Early Middle Ages From Late Antiquity to A.D. 1000
Find a Cow NOW!
Memoirs of a Political Officers Wife in Tibet, Sikkim, and Bhutan
The Wake of Iconoclasm Painting the Church in the Dutch Republic
Graven Images The Averillan Chronicles, Book 2
Music Therapy in Principle and Practice 2nd Edition
German Heavy Reconnaissance Vehicles
Panzer IV
Jungle Friends
Jigsaw Farm and Toy
The Shape of Cars to Come
Germany Military Trailers and Towed Equipment in WWII
CompTIA Security+ ETestPrep (SY0-301)
This Dark Earth
Agricultural and Rural Economics Agriculture and Rural Development 1st Edition
2000 Quotes from Hitlers 1000-Year Reich
Wicked Nights
The Faerie Guidance Oracle 1st Edition
The Boaters Medical Companion
The Law of Marine Collision
Women's Health
Black Heart
Uppity My Untold Story About the Games People Play
The Right Instrument for Your Child The Key to Unlocking Musical Potential
The Parisian&
Cartularium Saxonicum, AD 840947, Vol. 2 A Collection of Charters Relating to Anglo-Saxon History
China 50 Years Inside the People&
United States Navy Patches Series, Vol. 3 Fighter, Fighter-Attack, Recon. Squadrons
Tibetan Voices A Traditional Memoir
Perfect Country Rooms
Real Chocolate
Duncan, Family Life Education, 2 Edition + Ballard, Family Life Education With Diverse Populations
The Autism Puzzle Connecting the Dots Between Environmental Toxins and Rising Autism Rates
Morse Homology
Economies of Relation Money and Personalism in the Lusophone World
The Israel Museum, Jerusalem
Death in Sardinia
Mickey Mouse Issue XVI
Submerged
Trading Fundamentals
Cool Weather Fashions
Style to Go Kitchens Illustrated Edition
Garden Ornaments 30 Beautiful Projects for Decorating Your Garden Illustrated Edition
Strategies For Anger Management
Rethinking International Cooperation In Criminal Matters In The Eu Moving beyond Actors, Bringing L
Forever Ours Real Stories of Immortality and Living from a Forensic Pathologist 4 CDs Unabridged Edi
White on White Creating Elegant Rooms with Classic Whites
Quick and Easy Dresses to Sew
The Brain and the Meaning of Life
The Essential Christian Classics Collection
American Gladius A Study of the M-9 Multi-Purpose Bayonet System Mack
Robot Battle Paper Action Figures
The Secret Clocks Time Senses of Living Things
Russia and the West from Alexander to Putin Honor in International Relations
The Weather Observer's Hand
Vaidika Marriage Ceremonial = Vaidika Vivaha Samskara Vidhi
Journal of an Embassy from the Governor General of India to the Court of Ava, in the Year 1827
Translational Neuroscience Applications in Psychiatry, Neurology, and Neurodevelopmental Disorders
Like Dandelion Dust & This Side of H
Pausanias's Description of Greece, Vol. 3 Commentary on Books IIV
Pausanias's Description of Greece, Vol. 1 Translation
Teutonic Mythology
Iqbal in Politics
Problem Solving in Organizations A Methodological Handbook for Business and Management Students 2nd
Core Topics in Vascular Anaesthesia
An Introduction to Animal Behaviour 6th Edition
Yinyang The Way of Heaven and Earth in Chinese Thought and Culture
Judging Social Rights
Educative Tales of Bible
Old Errors and New Labels
The Postcolonial Low Countries Literature, Colonialism, and Multiculturalism
Blessed Assurance Inspiration from the Beloved Hymn
Sinful Chocolate
Love & Eroticism
Herbs and Spices
The Research Funding Toolkit How to Plan and Write Successful Grant Applications
Berlin Skyline
Redrawing Anthropology Materials, Movements, Lines
Correlations Between the Physical and Social Sciences
Captured Fire Seasonal and Sanctoral Cycle, Year Two
Joyce, T. S. Eliot, Auden, Beckett Great Shakespeareans
Molecular Approaches For Plant Fungal Disease Management 1st Edition
The Red Sea from Byzantium to the Caliphate AD 500-1000
Family Living Classics Simply Delicious Chocolate
Cultural Agility Building a Pipeline of Successful Global Professionals
Snow White Activity Book Green Edition
The House Gun A Novel
Church Signs A Humorous Look at the Faithful Side of Life
St Francis of Assisi
The Greatest Marian Prayers Their History, Meaning and Usage
Probability with Statistical Applications 2nd Edition
Felting Fever
City of Light
Higher Order Basis Based Integral Equation Solver
Handbook of Neural Activity Measurement
Current Developments in Algebraic Geometry 1st Edition
Classical Algebraic Geometry A Modern View
Modern Technology of Frozen Food Products
Zutot 2004
Perspectives on West Asia The Evolving Geopolitical Discourses
Education for Mental Health Rethinking Issues in Guidance and Counselling
Plant Nursery Management How to Start and Operate a Plant Nursery
Dynamics of India's Export Performances
Dr. V Nageswara Rao The Indian Evidence Act A Critical Commentary Covering Emering Issues and Intern
Heal's
Heirloom Afghans
Russia's Energy Policies National, Interregional and Global Levels
Savages
Triquarterly 103 An International Journal of Writing, Art, and Cultural Inquiry
A Social History of Iranian Cinema, Vol. 1 The Artisanal Era, 1897-1941
Lullaby Layettes
The Very Easy Guide to Using Your Sewing Machine
Ghost Jokes for Kids 1st Edition
Blindness A Family Matter
Over Time My Life as a Sportswriter
The Seductive Image Cinema and the Christian Faith
Announcing the Reign of God
Is the Bible Sexist?
Living or Nonliving?
Scripture in Context Essays on the Comparative Method
The Truth About William Shakespeare Fact, Fiction, and Modern Biographies
Carnivore Ecology and Conservation A Handbook of Techniques
Kiss That Frog! 12 Great Ways to Turn Negatives into Positives in Your Life and Work
The Apocalypse of John
Oscar and the Bird A Book About Electricity
The World Is a Prison
Discrete Mathematics Through Applications, Vol. 1
Journey of Love Reader
The Sun Gods Children The History, Culture, and Legends of the Blackfeet Indians
Do You Know
Emerging Risks A Strategic Management Guide
Corporate Governance After the Financial Crisis
Information Processing in Medical Imaging 16th International Conference, IPMI99, Visegrad, Hungary,
The Case of the School Ghost
An Apology for Apologetics A Study in the Logic of Interreligious Dialogue
Puppet on A Chain
What's Good for Business Business and American Politics since World War II
Enlightened Aid U.S. Development as Foreign Policy in Ethiopia
Urban Social Capital Civil Society and City Life
Telemorphosis
Ladder to Excellence in Homeopathic Education Education Technology, Education in Medicine Adaotation
Apocalypse of the Dead 13 CDs
Revisiting Literature Criticism and Aesthetics in India
Saltwater Fish
Me, the Queen and Christopher
Founders of Old Testament Criticism Biographical, Descriptive, and Critical Studies
Then They Came for Me 118 Days in Iran's Most Notorious Prison
Dream Catchers
I Am Food The Mass in Planetary Perspective
God in Three Persons
Terrorism and Public Health A Balanced Approach to Strengthening Systems and Protecting People
I Dont Want To go To Bed
Leadocracy Hiring More Great Leaders (Like You) into Public Service
Kapasi Sarcoma A Model of Oncogenesis
Jesus - Jeshua Studies in the Gospels
Notes, Critical and Practical, on the Book of Numbers Designed as a General Help to Biblical Readin
Portrait of Youth Ministry
Storm Clouds Over Chantel
Continental Britons German-Jewish Refugees from Nazi Germany Revised Edition
My Favourite Colouring Book-1
Father Knows Best [Boxed Set]
Colour Fun (Green)
The UK Competition Act A New Era for UK Competition Law
Jesus as God The New Testament Use of Theos in Reference to Jesus
Cold Fusion Aspects of the German Cultural Presence in Russia
Computer Today-7
Amazing Love True Stories of the Power of Forgiveness
Have Fun with Division
Nature In German History
An Introduction to Human Rights and the Common Law
Evaluation and Legal Theory
Dark Homecoming
Genesis and Semitic Tradition
Am I Sleeping with the Enemy? Males and Females in the Image of God
Go Positive Leading to Engage PW
The Tortious Liability of Statutory Bodies A Comparative and Economic Analysis of Five Cases
Cambridge Yearbook of European Legal Studies Vol 4, 2001
Fit To Serve Becoming What You Were Created To Be
Cambridge Yearbook of European Legal Studies, Vol. 14, 2011-2012
Age as an Equality Issue Legal and Policy Perspectives
Summer Sun Risin
Surgical Anatomy of the Ocular Adnexa A Clinical Approach
Unimaginable Atrocities Justice, Politics, and Rights at the War Crimes Tribunals
Building Arguments
Collected Resonance Shelly Bahl, Sarindar Dhaliwal,Farheen HaQ
Governance of Hospitals
Emerging Areas in Hospital Services
Hospitals in Community Health Care
Information Technology in Developing Human Resources
Yearn
Guidelines for Nurse Practitioners in Gynecologic Settings
Where There Is Evil New Edition
Organisation Theory and Designs Contemporary Concepts and Emerging Trends
The Hawks of London
Valley of Ashes
ICT Applications in Agribusiness and Extension Education
Women in Society 1st Edition
Income Tax Guidelines and Mini Ready Reckoner 1999-2000, 2000-2001 Alongwith Tax Planning Wealth an
Compendium of Government of India Notifications, Policy Circulars and Public Notices on input outpu
Participative Management Experience from Former Yugoslavia West Germany and India 1st Edition
The Creed of Buddha Reprint
Development of Mysticism in Kashmir 1st Cosmo Print
A Grammar of the Khassi Language Reprint London 1891 Edition
The did you Know that the World Ballot Comes From Little Balls and Other Fascinating Facts about the
Biolinguistics Exploring the Biology of Language
UK Public Law and European Law The Dynamics of Legal Integration
After National Democracy Rights, Law and Power in America and the New Europe
In the Company of Witches Illustrated Edition
Scourge of the Betrayer
Advancing Education with Information Communication Technologies Facilitating New Trends
Europe and Extraterritorial Asylum
Illustrated History of Southern Wagons, Vol. 3 SECR
Skyscrapers of the Midwest
Technological Advancements and Applications in Mobile Ad-Hoc Networks Research Trends
Collins Cobuild Pocket English-English-Telugu Dictionary Illustrated Edition
Redemption Song Muhammad Ali and the Spirit of the Sixties
Collection and Recollections Economic Paper and their Provenance
Social Movements in Advanced Capitalism The Political Economy and Cultural Construction of Social Ac
Planning for Tourism 1st Edition
The Origins of Islamic Law The Quran, the Muwatta and Madinan Amal 1st Indian Reprint
Quest in Reality
Sports Sociology
Lawyer Geisha Pink
The Magician King A Novel Illustrated Edition
Cultural Adaptations Tools for Evidence-Based Practice With Diverse Populations
Cropping Systems for Sustainble Farming 1st Edition
Ass et Recovery Handbook A Guide for Practitioners
Helicopter Crew Chief
The Vampire Fighters
Downhome Gospel African American Spiritual Activism in Wiregrass Country
Teasing Tongue Twisters
Public Administration New Challenges
Wheel of History 5th Edition
Educational Philosophy in Modern India 1st Edition
Biomechanics and Kinesiology of Human Motion
Educational Psychology Professional Applications 1st Edition
The Compact History of the Catholic Church 6th Print
Ayurveda Chikitsa 2nd Edition
The Meeting Point Based on Mahamati Prannath's Tartam Vani
Humanity's Dark Side Evil, Destructive Experience, and
After the Crash Psychological Assessment and Treatment of Survivors of Motor Vehicle Accidents 2nd E
Healing From Within The Use of Hypnosis in Women's Health Care
The History of the Future A Commentary on Revelation and Matthew 24
Guess Where?
Latino History Day by Day A Reference Guide to Events
Story of a Cockroach
Computer Engineering Concepts, Methodologies, Tools and Applications 4 Vols.
The Shamanic Odyssey Homer, Tolkien, and the Visionary Experience
Management Information Systems for Enterprise Applications Business Issues, Research and Solutions
Cerebrospinal Fluid Collections
Introducing Islam A Simple Introduction to Islam Reprint
The Spiritual Wisdom of Ancient Bharat 1st Edition
Nepal Government and Politics
Shikhar Salutations to the Himalaya 1st Edition
Smoke in the Sun
Pastrol Counselling
Data Dayal Maharishi Shiv Brat Lal Verman 1st Edition
How to Export : As per New Exim Policy and Procedures April 2000-01
How to Import - 2000-01
Zen and Japanese Buddhism 3rd Edition
Radiant Himalayas 1st Edition
Coromandel Fishermen An Ethnography of Pattanavar Subcaste
Show What You Know on the MSP Math Flash Cards Grade 4 Mathematic
The Psychological Meaning of Chaos Translating Theory Into Practice 1st Edition
Rural Energy Matters The Dhanawas Experience Reprint
The Assyrians and Their Neighbours
Endgame
The Wrong Answer Faster The Inside Story of Making the Machine that Trades Trillions
Birdies, Pars, Bogeys
Obesity Management
An Alliance of Spirit Museum & School Partnerships
Saving Grandmother's Face And Other Tales from Christian Teachers in China
Autobiography of a Modern Prophet
Theology and Praxis Epistemological Foundations
Maya Amazing Inventions You Can Build Yourself with 25 Projects 2nd Edition
Explore the Wild West! With 25 Great Projects
If You Dont Like the Possum, Enjoy the Sweet Potatoes Some Principles for Travel along the Road of
From the Sanctuary to the Streets How the Dreams of One City&apo
The Healing Power of Reiki A Modern Master's Approach to Emotional, Spi
Cunningham's Magical Sampler Collected
Four Square Writing in the Content Areas for Grades 5-9
The Medallion of Solaus
The Stones Release
The Signs of a Prophet The Prophetic Actions of Jesus
Revival Preachers and Politics in Thirteenth Century Italy The Great Devotion of 1233
A History of Optics from Greek Antiquity to the Nineteenth Century
Knight Everlasting
In My Father&
Translational Neuroscience A Guide to a Successful Program
All in the Family On Community and Incommensurability
The Way of Science Finding Truth and Meaning in a Scientific Worldview
China Airborne
So Brilliantly Clever Parker, Hulme & The Murder That Shocked The World
Lessons In Letting Go Confessions Of A Hoarder
For All Practical Purposes Mathematical Literacy In Today's Wor
Betting on China Chinese Stocks, American Stock Markets, and the Wagers on a New Dynamic in Global C
A Different Inequality The Politics Of Debate About Remote Aboriginal Australia
White Ginger
The Diamond Deep
Spook: Science Tackles the Afterlife
Quantum Coin
World Regional Geography Concepts
The Doctor and the Dinosaurs A Weird West Tale
The Real Story of Risk Adventures in a Hazardous World
Shadows
Genoa and the Sea Policy and Power in an Early Modern Maritime Republic, 15591684
Jack of Ravens
Queer in Russia A Story of Sex, Self, and the Other
Back to Delphi
Viva La Pizza! Pizza Boxes from Around the World
Shudraka Sanskrit Writer
Instructional Modules for AIDS Education
India & Hungary Perspectives on the Changing World Order
Studies on Man Issues and Challenges
Education Changing Scenario
Monetary Management in India
New Dimensions in Indo-Burmese Relations
Encyclopaedic Dictionary of Geology
Parental Involvement in the Education of Mentally Handicapped Children
Angels in the Fire The Dramatic True Story of an Impossible Rescue
The Olympics Strangest Moments Extraordinary But True Tales From The History Of The Olympic Games
The Rebirth of the Church Applying Paul's Vision for Ministry in Ou
Fairy Tail 29
Introducing Apologetics Cultivating Christian Commitment
Hard Man Hard Game
First Date
Besmel A Novel of the Iran-Iraq War
Do What Jesus Did A Real-Life Field Guide to Healing the Sick, Routing Demons and Changing Lives For
The Poetry Of Snowdonia
Organic Chemistry, Solution Manual/Study Guide &
Every Changing Shape
HIV/AIDS Prevention : Education for Educational Institutions
Women's Equality in India A Myth or Reality 1st Edition
Battle in the Sky
Intellect on Hold Awakening the Spirit
Panchayati Raj Institutions and Role of NGOs : The Experience in Mysore and Tumkur Districts of Karn
Meditation for Your Life Creating a Plan that Suits Your Style
Covenant and Creation A Theology of Old Testament Covenants
Is Mormonism Now Christian?
Plunging into the Kingdom Way Practicing the Shared Strokes of Community, Hospitality, Justice, and
From the Dust
Trinitarian Theology after Barth
Economic Development and Status of Women in India The Case of Haryana 1st Edition
Dr. B.R. Ambedkar More Than a Dalit Voice
India's Legendary East Coast
TextBook of Engineering Mathematics, Vol. 1
The Widening Gyre Post Modern Crisis and Yeat's Vision
Remembering Tibet The Paintings of Sonam Dhoudup, Catalogue of a Painting Exhibition held in Dharam
Indian and Global Crises of Man Society, Culture and Civilisation Yesterday, Today and Tomorrow
Human Resource Management Perspectives for the New Era 1st Edition
Metal Implements in Ancient India From Earliest Time Upto Circa 2nd Century B.C. 1st Edition
Contemporary Political Thinking
Direct Taxes Law and Practice - 2000-2001 35th Edition
Tourists Consumption Pattern and Its Economic Impact in Nepal
Women and Marriage 1st Edition
The Global World of Indian Merchants, 1750-1947 Traders of Sind from Bukhara to Panama 1st Published
HRD for Local Government : Training Agenda for Municipal Bodies
Alternative Economic Survey, 1998-2000 Two Years of Market Fundamentalism
Applied Microbiology 1st Published
Coordination Chemistry
A Critique of the Nuclear Programme
Women in Politics 1st Edition
Economics Reforms and Poverty Reduction 1st Edition
Widowhood A Curse to Humanity 1st Edition
Race : Ethnicity and Women 1st Edition
Rethinking Indian English Literature
Indian Education into Millennium
Modern English Literature, 1798-1919
Finance and Economic Innovations
Food and Community Nutrition 1st Edition
Health and Meal Management
Integrated Watershed Management Productive and Sustainable Development
Leadership in Industrial Setting
Sociology of Indian Literature A Sociological Study of Hindi Novels
Ethnicity in Urban Context The Gujaratis in Madras City
Class Formation and Peasantry
The Yoga and its Objects 11th Edition
Gribov Memorial Volume Quarks, Hadrons, and Strong Interactions : Proceedings of the Memorial Worksh
Cricket Oddities
Enciclopedia Del Vino
The As/400 Programmer's Handbook A Toolbox Of Examples For Every As/400 Programmer
The Glory of Heaven Inspiring True Stories and Answers to Common Questions
Education in India
Media Education Reprint
Role of Microbes in the Management of Environmental Pollution 1st Edition
Goa's Foremost Nationalist Jose Inacio Candido de Loyola (The Man and His Writings)
Social Justice and Empowerment
Democracy in Danger Criminality and Corruption in Lok Sabha Elections
Handbook of Journalism Style and Substance 2nd Edition
C.Y. Chintamani The Unique Administrator and Journalist
Immunobiology
Raja Rao An Anthology of Recent Criticism 1st Edition
Rise of Maratha Power in India 1st Edition
Buddhist Art in India
Nuclear Diplomacy The Art of the Deal
Principles of Guidance and Counselling
Women in the Buddhist Legends 1st Edition
The Path to Enlightenment Svayambhu Stotra 1st Edition
Trade and Development Report 1999 Fragile Recovery and Risks Trade, Finance ad Growth
Glimpses of Sri Lankan Buddhism 1st Edition
Stalking Terror : Land Mines in Peace and in War
Citizenship Development Western Mores Eastern Values
The Mahadev Kolis
Inter-Racial Marriages in London
Management-White Collar Relations
The Marathi Theatre
President Zakir Husain A Quest for Excellence
Theory of Profit
Vanishing Forests
The Indian Economic Conference Papers 1979 Savings Behaviour in India
South Asia Towards Dynamism and Cooperation
Regional Study of Industrial Development of Vidarbha
Aid to Collaboration A Study in Indo-U.S. Economic Relations
Groundnut Marketing
Mediation, Concilation and Arbitration
Agricultural Labour, Wages and Living Conditions in Meerut
Perspectives in Pre-School Education
Robert Frost
Monarchy in Nepal Imprisonment to Glory Tribhuvan Era in Nepal
Poems of Vinda
Micro-corneal and Soft Contact Lenses Prescribing and Fitting Techniques
Politics of Indian Economy
Through the Indian Looking Glass
In the City of Dazzling Distortions Stories 1st Edition
Science of Archaeology in India
Analysis of Friendship for the Next Millennium
Encyclopaedia of Women in Sports
WTO in the New Millennium Commentary, Case Law, Legal Texts
Rural Development in Nagaland
Handbook of Higher Education
Green Politics, 1999
Culture, Democracy and Development
Musikavamsamahakavyam Atulakavikrtam (Atulakavi's Musikavam
China The Middle Way Of The Middle Kingdom
Ligny's Lake The Race To Solve The Riddles Of A Vanishing Man
Mariquilla En La Nieve
Idealism, Pragmatism, and Feminism The Philosophy of Ella Lyman Cabot
Dolled Up to Die A Novel
Comparative Concepts, Profiles Themes and Movements
Cost Accounting and Cost Control 4th Revised & Enlarged
Bhartrhari The Grammarian 1st Published
Gleanings of the Past and the Science Movement In the Diaries of Drs. Mahendralal and Amritalal Sirc
Ramshankar Ray
The Craft of Poe's Tales 1st Edition
Grassland Techniques and Management 1st Edition
Integrated Management of Plant Resources
Morality and Religion A Critical Study 1st Edition
Applied Biology
A Textbook of Human Rights
The Psychology of Reasoning
She Had Some Horses: Poems
The Neuroscience of Human Relationships: Attachment And the Developing Social Brain (Norton Series o
The Dao of Neuroscience Combining Eastern and Western Principles for Optimal Therapeutic Change
Lighthouses (Norton/Library of Congress Visual Sourcebooks in Architecture, Design & Enginee
A Clockwork Orange Reprint
Engaging Cinema: An Introduction to Film Studies
The Norton Book of Science Fiction (Norton Book Of...)
Palliative Care for the Elderly in India
Feel Good & Bad Factor in diffrent sector
Biopsychosocial Issues in Positive Health
Higher Education Social Political and Economic Challenges
Handbook of Research Methods in Tourism
The Taliban Cricket Club
Cost Audit Practice Manual
Guide to Tax Audit As Amended by Finance Act 2011 6th Edition
Company Law and Practice 16th Edition
Encyclopaedia of Educational Development and Economic Reforms
2012 TLVs and BEIs ACGIH, TLVs and BEIs 1st Edition
Teaching Ethically Challenges and Opportunities
Bowel Care & Digestive Disorders
God Politics
Question Bank for Agricultural Competitions Useful for JRF SRF NET CET and PhD
Biodiversity and Insect Pests Key Issues for Sustainable Management
English Literary Criticism and Indian Poetics (Upto 18th Century)
True Stories of Mystic Places
Sherlock Holmes (collection - 3)
Maximum Maiden The Unauthorised Biography Of Iron Maiden
The Woody Guthrie Story
The American Red Cross from Clara Barton to the New Deal
Vinacular A Wine Lover's A-Z
The Riddle Of The Sands
Collected Poems Greg Delanty, 1986-2006
The Lipizzaner
John Dowie A Life In The Round
Maximum Bon Jovi The Unauthorised Biography Of Bon Jovi
Believing The Neuroscience of Fantasies, Fears and Convictions
Grandma and Me at the Flea Los Meros Meros Remateros
Ecology, Technology And Culture Essays In Environmental Philosophy
Zippo A Dark Futuristic Novel
This Wheel&a
The Emerald City Of Oz
Stories that Move Mountains Storytelling and Visual Design for Persuasive Presentations
Uremic Toxins by Mass Spectrometry 1st Edition
Nineteenth Century British and American Poetry (Second Half)
Banking and Insurance 1st Edition
Open Access Movement in the Age of Innovation and ICT 1st Edition
Approaches to Teaching Shelly's Poetry
Textbook of Algae
Contemporary Issues in Public Accountability and Audit Institute of Public Auditors of India, New De
Child Rights In the New Era
My Body Slide n Hide
The Cosmic Mountain in Canaan and the Old Testament
Brand Equity Strategies
Technology for Facility Managers The Impact of Cutting-Edge Technology on Facility Management
Love You To Death - Season 4 The Unofficial Companion To The Vampire Diaries
New Beginnings Ten Teachings For Making The Rest Of Your Life The Best Of Your Life
Starfish Biology and Ecology of the Asteroidea
L.P. Vidyarthi : Contribution to the Development of Anthropology
The Cost of Discipleship : Meditations During Lent and Holy Week
Ghostly Tyne And Wear
Into the Whirlwind A Novel
Triumvirate: McKim, Mead & W
Zen of Seeing: Seeing/Drawing as Meditation
A Mencken Chrestomathy: His Own Selection of His Choicest Writing
The Best Nest (Beginner Books(R))
Aliens for Breakfast
The Little Rabbit (Pictureback(R))
The Missing Tooth (Step into Reading, Step 3)
Mike Mulligan and His Steam Shovel
Ira Sleeps Over
The Whingdingdilly
The Scottish Heather Book
Towards a Fuller Humanity : A Theological Reflection on Christian Understanding on Human Rights
Problems of Ancient India 1st Edition
V.N. Shukla's Constitution of India Reprint
Handbook of Weaving 1st Indian Edition
Environment, Energy, Health Planning for Conservation 1st Edition
Land Development Banking in India
Decentralised Planning for Development in India
Foreign Trade Aid and Development in Nepal
Foreign Aid and India's Economic Development
Thrust Sectors in India's Exports 1st Edition
Management Planning and Policy Making
Educational Innovations Institutional Profiles and Case Studies 1st Edition
Meaningful Interaction with Culturally Different Students
Physics Education 1st Edition
Caste and Politics in Bihar
International Images and Structural Balance
World War II Medical Services : India 1st Edition
Accounting and Finance for Managers
All You Wanted to Know About Meditation
Human Well-Being Socio-Economic Indicators A Global Study
In Search of Fair Play Street and Working Children Speak About their Rights
Kasturba Gandhi The Sage of Satyagraha 1st Edition
Indian Beauty Secrets Pamper Your Body and Soul 1st Indian Edition
Shivaji and the Emergence of Marathas
A Stylistic and Semantic Study of Two Partition Novels 1st Edition
Banaras Visions of a Living Ancient Tradition
The Lion of Parliament Dr. Syama Prasad Mookerjee 1st Edition
Managing Human Resource Development An Indian Perspective
Bank Finance to Corporate Sector in India
Financial Management of Public Undertakings
Financing of Public Enterprises and Public Participation
Regional Rural Banks and Rural Development
Company Directors Under Company Law
Georges Sorel, His Thoughts and Works
Political Science Annual - 1998-99 Focus on Political Theory
Birthday Messages, 1955-79 2nd Edition
Reality Behind Life 1st Edition
Meditations Creative Visualization and Meditation Exercises to Enrich Your Life
Teaching and Coaching Tennis
Managing People Effectively : Managerial Experiences - 100 Case Studies
Welfare, Choice and Development Essays in Honour of Professor Amartya Sen
Administrators Missionaries and a World Turned Upside Down
Quest for Justice Perspectives on Mission of Unity
Chemistry of Transition Elements
Molecular Genetics
Tribal Women Empowerment and Gender Issues 1st Edition
Research Trends in Modern Botany [Morphological, Anatomical, Embryological and Chemosystematic Studi
We Have a Baby
Katie And The Starry Night
Mammon
Curtiss P-40 Snub-Nosed Kittyhawks and Warhawks
Haunted Tunbridge Wells
The Black Rose Book Two In The Seven Stars Trilogy
Food The Essential A-Z Guide
Gold Coast Madam The Secret Life Of Rose Laws
Distracted Settlement New South Wales After Bligh From The Journal Of Lieutenant James Finucane, 180
Dog in the Manger
La Jugueteria Errante Un Misterio Para Gervase Fen
Global Warming and Climate Change
Post Modern Literary Theory
Benefits Management How to Increase the Business Value of Your It Projects
Indirect Tax Law & Practice (June) 2009
Between a Mother and her Child
Small Waterplane Area Ships
Automated Management of Library Collection
Family Planning Programme and Beyond Policy and Administration
Education and Manpower Planning
Long-Term Fiscal Policy and Planning in India
Housing Laws in India Problems and Remedies : Covering; Flats and Apartments Promoters, Builders and
Democracy in India
WTO and the Indian Economy Reprint
Philosophy of Wittgenstein India Responses 1st Edition
Managing Multilingualism in India Political and Linguistics Manifestations 1st Published
All You Wanted to Know About Dreams
Eminent Indian English Writers An Assessment 1st Edition
The Sociology of International Politics 1st Cosmo Print
Recent Trends in Diseases Management of Fruits and Seeds 1st Edition
World Economic and Social Survey, 2000 Trends and Policies in the World Economy
For the Soul Thought
Sarup's Dictionary of Biotechnology
Problems in Finsler Space
Wake up Laughing My Miraculous Life and Sai Baba
Police Internal Security and Developmental Disorder in India
Public Administration and the State
President's Rule in India
Macro Theories of Distribution
Social Change and Violence The Indian Experience
Tribal Development in India
Islam and its Founder Indian Edition
Secularism and Constitutionality
Globalization and Nationalism The Changing Balance of India's Economic
El Libro De Las Maravillas
Ravi Likhda Hai
Raising Hell Ken Russell And The Unmaking Of The Devils
Panjwa Sahibzada
Roshnia Da Baghban
Cinco Madres, Cinco Historias 2nd Edition
Unfinished Lives Reviving the Memories of LGBTQ Hate Crimes Victims
Cynic Sage or Son of God? Recovering the Real Jesus in an Age of Revisionist Replies
Why Four Gospels?
London - Eyewitness Travel Family Guide Illustrated Edition
Paradigms Lost Fighting Stigma and the Lessons Learned
Sarghi
Battle Story Maiwand 1880
The Lost Grizzlies: A Search for Survivors in the Wilderness of Colorado
Pink and Say
Today Is Monday
Cuaderno De Ejercicios Para Dormir Bien
El Hombre Perro
Gulabi Pagg
The Rhino Keepers Struggle For Survival
Panah
El Tren
How to Create the Perfect Wife Britain's Most Ineligible Bachelor and his Enlig
Closing The Gap Lombardi, The Packers Dynasty, And The Pursuit Of Excellence
Clinker Boat Building A Guide To Traditional Techniques
Excel 2010 Business Basics & Beyond
The Insightful Teacher Reflective Strategies To Shape Your Early Childhood Classroom
Functional Equations and Inequalities in Several Variables
Tribes of Assam and Manipur Reprint
Kashmir The Constitutional Status 1st Edition
Contemporary Indian Society (Part II) 1st Edition
Realism and Revelation in Graham Greene 1st Edition
Automobile Pollution
In Their Shadows A Collection of Four Stories
Story of the I.N.A. Reprint
Human Rights Education Conceptual and Pedagogical Aspects 1st Edition
Basic Structure and Constitutional Amendments Limitations and Justiciability
Kindle Life Reprint
Indian Rural Problems
Frontiers of Anthropology 1st Edition
Infrastructure Development Under Economic Reforms 1st Edition
Naradasmrti Historical, Sociological, Political and Legal Study 1st Published
Writings of Allama Abdullah Yusuf Ali
Al-Hadiyato-Linnisa Islamic Laws Regarding Purity for Women 1st Edition
Library Preservation and Automation 1st Edition
Dr. H.S. Gour's Law Relating to Theft, Robbery and Dacoity Alon
The Zombie Tarot An Oracle of the Undead with Deck and Instructions
Dynamics of Non-Formal Education 1st Edition
Meditation : Simran 1st Reprint
Living Words Soul-Kindlers for the New Millennium : Gleanings form the Works of Sri Aurobindo and th
All in a Stride Reflections of a Civil Servant 1st Edition
The Black Book of Gujarat 1st Edition
Coaching Successfully Basketball
Coaching Successfully Weight Training
Medicine and Life Sciences in India Vol. 4, Part 2 Reprint
The Indian Air Force A Balanced Strategic and Tactical Application
Islamic Views on Human Rights Viewpoints of Iranian Scholars 1st Indian Edition
Food Science and Applications in Indian Cookery 1st Edition
Good News New Testament with Psalms
Quotes and Anecdotes An Anthology for Preachers & Teachers 7th Print
Israel in the Old Testament
Here and Now : Living in the Spirit
New Girl Law Drafting A Future For Cambodia
Devotion to the Divine Mercy of God (Novena & Chaplet)
Mary : Star of the New Millennium Guiding Us to Renewal Reprint
Southeast Asian/American Studies
The Voice and the Will Subaltern Agency : Forms and Motives 1st Edition
Managing for Value
On Cleaning Bookshelves 1st Published
Supreme Court Yearly Digest, 2001 With Table of Overruled, Reversed, Followed, etc., Cases, List of
Conservation Science 1st Published
Business Methods and Machinery
Economic Geography of India
Manipur The Jewel of India 1st Edition
Information Technology in Higher Education
Restaurant Management 1st Edition
The Art of Commonsense Living 2nd Print
Rural Women and Grassroot Organisations Expectations and Outcomes
Staff and Service Management
Ramacaritamanasa in South Africa 1st Edition
Rural Economy and Society Study of South-Eastern Rajasthan During the Eighteenth Century
The Country of the Sikhs Punjab (The Punjab Under the Sikh Rule, 1799 AD to 1849 AD)
Jane Austen's Heroes And Other Male Characters : A Sociological
Sanjeev Kapoor's Any Time Temptations 2nd R
Religious Thought in India 1st Edition
Aquarium Fish Keeping 1st Edition
A Glossary of Some Terms Used in Development and Planning
A Glossary of Terms in Regional Planning and Development
Computer Fundamentals and Programming 1st Edition
A First Course in Programming with C Reprint
Seducing Pain 1st Edition
Lord Lawrence and Reconstruction of India Under the Crown
Phases of Indian Civilization A Historical and Cultural Outline
Child Labour in India 1st Edition
Women in India An Exhaustive Study 1st Edition
Punjab Fairs and Festivals
Birsa Munda and His Movement, 1872-1901 A Study of a Millenarian Movement in Chotanagpur A Centennia
Conversions and Citizenry Goa Under Portugal 1510-1610 1st Edition
Sex Education 9th Print
Current Issues in Modern Education 1st Edition
Where I Want to Be
Peace, Locomotion
Leaves
Sex Over 50
It's Not about Food End You
Weather Whys
Social Development and Planning in Asia 1st Edition
Psychology of Reading Role of Orthographic Features 1st Edition
Economic Development and Political Democracy The Interaction of Economics and Politics in Independen
Taxmann's Natural Justice, Judicial Review &
Climate, Weather and Crops in India
Appreciation Programme for Senior Executives on Recent Developments in Rock Mechanics and Tunnelling
Transformation of Herbicidal Technology Chemical Based to Ecological Concern 1st Edition
The Taste Divine Indian Vegetarian Cooking the Natural Way
Abelardian Semiotics and Other Essays
Abuse of Christian Woman in India and Remedy in 12 Biblical Studies on Equality of Man and Woman 2nd
Basic Ideas in Educational Psychology 2nd Edition
Food Processing Biotechnological Applications 1st Edition
Competitive Advantage Through Knowledge Management 1st Edition
St. Anthony of Padua A Warm-Hearted Saint
Perspective on Current Affairs 1st Edition
A Textbook of Indian Tourism
Teaching Languages to Young Learners
New Century : Whose Century? The Evolution and Interaction of Technology, Economy, Polity and Societ
Development Strategies for Library and Information Science
Introduction to Computers and Basic Programming 2nd Edition
Special Functions Selected Articles-Proceedings of the First National Conference of the Society for
Sakti Cult in Orissa 1st Published
Asia and Twice Born Prometheus Historical Epic Revealed 1st Edition
Renewables Products and Markets
Hindu Dances
The Nature of Living Tradition Distinctive Features of Indian Parampara 1st Edition
Managing the Indian State National
Japanese Street Style 1st Edition
In the Land of Jesus A Travelogue
The Picture Book
Fractures and Their Complications
Ocean Life
The Philosophical Life Twelve Great Thinkers and the Search for Wisdom, from Socrates to Nietzsche I
Correct English Usage
Economic Developments in India (EDI) : Monthly Update, Volume 52 Analysis, Reports, Policy Documents
Encyclopaedic Dictionary of Science
Into the Heart of Faith : Ten Steps on the Journey
The Cambridge Companion to Wittgenstein
Patterns of Speculation A Study in Observational Econophysics 1st Edition
In the Wonderland of Investment for NRIs Financial Year, 2003-2004, Assessment Year, 2004-2005 4th R
Common Symptoms Effective Remedies 2nd Edition
History of Biology
Corporate Instinct
Intranets
Prem Chand Hindi Novelist and Story-Writer
Bharatiya Samskriti Spectrum of India's Culture 1st Edi
Bhagavad Gita for 21st Century Way to Add Years to Life and Add Life to Years 1st Edition
Extraordinary Performances from Ordinary People
Malavikagnimitra of Kalidasa Edited With a Complete Translation Into English, Notes (Critical and E
United Nations and Indian Mysticism Parallels on Human Rights and Police 1st Edition
Exploring Spirituality A Step-by-Step Guide to Finding and Following Your Own Spiritual Path Reprint
Environmental Perspectives in India 1st Edition
Ecclesia Divina or A Selection of Hymns From the Four Vedas Reprint
Atomic Structure 1st Edition
Jurisprudence and Legal Theory 3rd Edition, Reprint
Glossary of Terms and Expressions in Sales Tax With Supplement
Sri Shivsahasranamavali (Stotram & Namavali)
Supreme Court Yearly Digest, 2002 With table of Overruled, Reversed, Followed, etc. Cases, List of A
A Text Book of Marketing Research 1st Edition
Global Human Growth Model 1st Edition
Office Organisaton and Management 1st Edition
Mercantile Law and Indutrial Law 1st Edition
Kalidas Bhattacharyya 1st Edition
Handbook of Libraries and Librarians in India 1st Edition
Modern Principles of Athletic Training
Public Administration in the New Millennium Challenges and Prospects 1st Edition
Computer Applications in Management Reprint
The Vedant Philosophy
Sociology and Unpredictability in the Growth of Science and Technology
Current Trends in Industrial and Applied Mathematics
Food, Health and Vitamins
God and Self-Realization A Scientific and Spiritual View 1st Indian Edition
Management and Utilization of Bamboo and Rattan in Papua New Guinea
Physical Education Foundation
Verbal forms in the Rgveda 4th Mandala 1st Edition
Dynamics of International Relations 1st Edition
Engineering Graphics Anna University Syllabus-2004-5 5th Edition
Bharat's Income Tax Act With Departmental Views (Containing Gist of
The Funny Side of English A Read-n-Laugh Manual to the English Language
Glimpses of Sikh Religion
Inflation Accounting Practices in India's Corporate Sector
Traditional Self-Governing Institutions Among the Hill Tribes of North - East India 1st Edition
Path-Integral Methods and their Applications 1st Indian Reprint
Congress-Muslim League Tussle - 1937-40 A Critical Analysis 1st Edition
Constitutional Safeguards for Scheduled Caste and Scheduled Tribes 1st Edition
Development Communication and Information Economics in the New Millennium
When the Vulture Descends
Yoga Pushpanjali A Treatise on Astrological Combinations 1st Edition
Money Laundering An Insight into the Dark World of Financial Frauds 1st Edition
An Introduction to Eastern Ways of Thinking 1st Edition
Religion and Philosophy for Modern Youth
Rural-Urban Divide Changing Spatial Pattern of Social Variables 1st Edition
Transformation of India as a Knowledge Superpower Strategies for Action 1st Edition
A Treatise on Hydromechanics
Abandoned and Betrayed Afghan Refugees Under UNHCR Protection in New Delhi
Arpan
Consumer Protection and Redressal Machinery in India 1st Edition
Tribal Welfare and Development Emerging Role of Anthropological Explorations 1st Edition
Principles and Practices of Therapeutic Massage 1st Edition
Downfall of Mughal Empire 1st Edition
Indigo Dictionary of Business The Most Comprehensive, Authoritative, and up-to-date Work Available,
Islamic Aadaab
Differential Calculus 1st Edition
The Home and the World
Bobby Blues
Tales of the Poles
50 Aesop's Fables
Summary Proceedings of the First ICRISAT Regional Groundnut Meeting for West Africa, 13-16 Sep 1988,
Duty Drawback - 2003-04
Panchayati Raj in India Theory and Practice 1st Edition
How to Really Love Your Husband
Religions of the Hindus Essays and Lectures
Juma ke Khutbe Collections of Sacred Congregational Sermons Delivered on Eve of Fridays and Eidain I
Presidents Speak to the Nation Republic Day Speeches, 1950-2000
Presidential Addresses on Arab-Islamic Studies
Life and Work of Muhammad Jalal-Ud-Din Rumi
Internet Technologies
Alternatives in Agriculture Punjab
Local Environment and Lived Experience The Mountain Women of Himachal Pradesh 1st Edition
Secular Gods Blame Hindu Demons The Sangh Parivar Through the Mirror of Distortion 1st Edition
Work Education
Marine Ecosystems 1st Edition
Contemporary Education 1st Edition
Asia-Pacific Security, Globalisation, and Development
Early Brahmanical Cults and Associated Iconography c. 400 B.C. to A.D. 600
Mahrattas, Sikhs and Southern Sultans of India Their Fight Against Foreign Power Reprint Edition
Justice System and Mutinies in British India Reprint Edition
Akshay Kumar Dutta
Bankimchandra Chatterjee Bengali Novelist Reprint
Pandit Atambapu Sharma Manipuri Writer
A Home at Last
The Islamic Art of Persia 1st Published
Kargil The Tables Turned
A Simple Guide to Muslim Prayers
Some Aspects of Jainism in Eastern India 1st Edition
The Sikh Gurus and the Sikh Religion 1st Edition
Nyayabhasyavarttika of Bharadvaja Uddyotakara, Vol. 3 1st Edition
Antiquities of Northern Tibet Pre-Buddhist Archaeological Discoveries on the High Plateau (Findings
Nepal An Exotic Tourist Destination 1st Edition
Financial Analysis
The Fiction of Bharati Mukherjee A Cultural Perspective 1st Edition
English Vocabulary 1st Edition
Orient Book of Quotations
Writing Effectively
World's Greatest Puzzles
More Sherlock Holmes Puzzles 3rd Printing
Ethics Management 1st Edition
Medical Geography of Indian Tribes 1st Edition
Migration in the Third World - 1954-1994 Views and Reviews 1st Edition
Basics of Programming and OOPs Concept
Daughters of the Earth Women and Land in Uttar Pradesh
Lahore - 1947 2nd Edition
Educational Psychology An Introducation 1st Edition
Effective Professional Management 1st Edition
Fundamentals of Modern Physics
Information Technology Management in Libraries 1st Edition
Systems and Practices of Effective Library
Distance Education Challenge and Response 1st Edition
Quality Education 1st Edition
Mantrasara (The Essential Matins)
Construction Innovation and Process Improvement
Deadly Legacy
Sediments, Morphology And Sedimentary Processes On Continental Shelves Advances In Technologies, Res
Injuries of Knee and Leg
Plantwide Control Recent Developments and Applications
Managing with Plans and Budgets in Health and Social Care
Ethnic Business: Chinese Capitalism in Southeast Asia
Biology Question Bank
Training for Leadership 2nd Impression
Religious Concept of Sin 1st Edition
Cognitive Development of Culturally Deprived Children 1st Edition
Time and Work
The Commonsense on the War on Iraq
Manual of Laboratory Procedures for Quality Evaluation of Sorghum and Pearl Millet
Proceedings of the International Pearl Millet Workshop, 7-11 April 1986, ICRISAT Center, India
The (Un) Common Sense of Advertising Getting the Basics Rights 3rd Printing
Socio-Economic Development of Indian Tribes 1st Edition
Dictionary of Subject Titles 1st Edition
Upanished The Real Truth
Playing Field Measurement Manual
A-Z Illustrated Encyclopaedia of Science and Technology
Badminton Skills and Rules
Art and Architecture Remains in the Western Terai Region of Nepal
Defending the Earth A Way of Life - A Handbook for Earthkeeping Reprint
Penumbra Life Coming Out of the Shadows : A Novel
Jeroboam II The King and Amos the Prophet : A Social-Scientific Study on the Israelite Society durin
Masters or Stewards A Theological Reflection on Ecology and Environment
Networking of Universities, Research Institutions and Industry
Understanding Major Pains Headaches, Migraines, Arthritis, Backbone Pain, Angina and a Host of Abdom
Marching Ahead with Science Science and Technology in India since Independence 1st Edition
The Indian Empire Its People, History and Products : Indian vernaculars and their Literature (pp 325
Settlements in the Yamuna-Hindon Doab An Archaeological Perspective 1st Edition
A Study of Hinduism
Career in Insurance
Play and Learn Swimming
Play and Learn Table Tennis
Supreme Court Minority Educational Institutions Cases : T.M.A. Pai Foundation Vs. State of Karnataka
A Critical History of the English Muse
Genetics 1st Edition
Geometry in Ancient India
Valuation of Perquisites Under Income Tax Act
Advanced Readings in Comparative Government and Politics Issues and Challenges 3 Vols. 2nd Revised E
Alienation An Existentialist Concept
All India National Congress 4 Vols. 1st Edition
Antiquity to Modernity in Tribal India 4 Vols. 1st Edition
Bank Lending Law and Practice
Advances in Fish and Wildlife Ecology and Biology Vol. 2
Committees and Commissions in Pre-Independence India : 1897-1902 Vol. 3 1st Edition
Financial Management Theory & Practice
Economyths How the Science of Complex Systems Is Transforming Economic Thought Illustrated Edition
Civil Engineering Project Management
Dermatology & Venereology Pre Pg Test Review
Hip-Hop Nature Boy and Other Poems
Race, Racial Attitudes and Stratification Beliefs
Who Was Steve Jobs? Who Was...?
An Introduction To Medicinal Chemistry
Comprehensive Dermatologic Drug Therapy
Complete Green Series Bundle The Sage Reference Series on Green Society
The International Student's Survival Guide How to Get the Most from Studying at
Ultimate Music Variety CD
Maths Made Easy Key Stage 2 Advance
Blotto, Twinks and the Dead Dowager Duchess First Edition
Biopiracy The Plunder of Nature and Knowledge Indian Edition
India's Foreign Policy Nehru to Vajpayee 1st Edition
Modern Americal Literature
Phytohormones in Crop Productivity Under Different Environments 1st Edition
Ethnoarchaeology in Action 1st Published
Intercultural Communication An Agenda for Developing Countries
Future Library Technology 1st Edition
Emerging Issues of Indian Economic Development 1st Edition
Pricing of New Issues in Indian Capital Market
Effective Personnel Management 1st Edition
Environment and Agricultural Pollution 1st Edition
Parties Elections and Mobilisation
Red Light Area Social Environment of Sex Workers 1st Edition
Business Finance
Cleaner Air and Better Transport Making Informed Choices
A Tree in my Village
Islamic World Inter-State Relations 1st Edition
World Conference on Education for All 1st Edition
Twist of Truth 1st Edition
Video Acquisitions and Cataloguing 1st Edition
Taxation and Corporate Dividend Behaviour in India
Biochemistry The Practice Portfolio of Latest Questions
D.P. Mishra The Man and His Ideology
Dangers of Information Technology Emerging Threats to Individual Privacy 1st Edition
A Primer of Literary Criticism 1st Edition
Praxis Oriented Lent
Go and Make Disciples 2nd Reprint
A Guide to Jeremiah 2nd Reprint
Plights in Prison
Shelter for All
Dangerous : Drugs Drinks and Tobacco
Active Society and Behavioural Therapy 1st Edition
Entrepreneurship Development in India 1st Edition
Administrative Discretion and Judicial Review 1st Edition
Selected Doctrines from Indian Philosophy 1st Edition
A Textbook of Helminthes
International Money and Finance An Analysis of New Global Architecture
Marketing Channel Management A Customer-Centric Approach 14th Printing
All You Wanted to Know About Diarrhoea
Essence of Buddhism A Collection of World Famous Quotations 1st Edition
Research Priorities in North-East India With Special Reference in Manipur
Sarup Dictionary of Difficult Words 1st Edition
Geography of a Himalayan Kingdom : Bhutan 1st Published
Guwahati : The Gateway to the East
Play Better Cricket
Play Better Diving
Bitter to Better Harvest Post Green Revolution : Agricultural and Marketing Strategy for India 1st E
Population-Health Literacy Concept, Content and Communication 1st Edition
Social Development 1st Published
Working Capital Management : A Comparative Study 1st Edition
Population Education 1st Edition
Staff Management and Information Work 1st Edition
A-Z Handbook of Health Education and Sports : Muscles of the Abdomen and Thorax
Jahangir's India The Remonstrantie of Francisco Pelsaert Reprint
Role of Panchayati Raj Institutions for Rural Development 1st Edition
Textbook of Psychology
Tribes of Car Nicobar
Roots of Confrontation in South Asia
Education in Information Age 1st Edition
Role of Computers in Library Science 1st Edition
Subject Analysis in Online Cataloging 1st Edition
Indian Economy Reflections from the First Decade of Reforms 1st Edition
Manual of Laboratory Specimens-Chordates
Information Technology and Total Quality Management
William Shakespeare King Richard-II
Joint Forest Management in Assam
Philosophical Psychology of Soul Mechanism Oriental and Occidental Studies 1st Edition
Rajasthan's Silver Jewellery A Living Legacy 1st Edition
Orthopaedic Manifestations and Bone Changes in Sickle Cell Haemoglobinopathy
El Despido Interior En La Pareja Que Nos Ha Ocurrido?
Encyclopaedia of Cooperative Management 5 Vols.
A Pali Reader - With Notes and Glossary (Text and Notes) Vol. 1 2nd Reprint Copenhagen 1901 Edition
Ancient Indian Heritage Varahamihira's Indi
Anthropology of Development Commemoration Volume in the Honour of Professor I.P. Singh 1st Edition
Buddhist Essays - I Five Titles
Encyclopaedic Dictionary of Marketing 2 Vols. 1st Edition
Encyclopaedic Dictionary of Religion and Ethics 3 Vols. 1st Edition
Heterosis and Hybrid Seed Production in Agronomic Crops
Contemporary American-Jewish Novel 2 Vols. 1st Edition
Contemporary Sources of the Mediaeval and Modern History of Bundelkhand - 1531-1857 Panna Records 16
Census of Agriculture - 2002 Sri Lanka (Small Holding Sector) : Anuradhapura District Preliminary Re
Demographic and Health Survey Sri Lanka, 2000 Preliminary Report 1st Print
Agricultural Crops and Livestock, 1992/93 Colombo District : Preliminary Report
Among My Souvenirs A Novel
Sometimes there is no Blood Domestic Violence and Rape in Rural Sri Lanka - Report
Encyclopedia of Strategic Management
The English Works of Raja Rammohan Roy With an English Translation of Tuhfatul Muwahhiddin 4 Vols.
Weekly Retail Prices Colombo City January 2000 - December 2000
Fury A Novel
History of Bagree-Rajya (Garhbeta) With Special Reference to its Anti-British Role, from Late 18th C
Political Orientation of People in Rural India A Study of Bihar With Reference to Antecedents and C
The Socio-Cultural World of Women in Medieval Andhra From 11th to 13th Centuries A.D.
Weekly Retail Prices Colombo City January 1995 - December 1995
Census of Agriculture, 2002, Sri Lanka Small Holding Sector : Puttalam District - Preliminary Report
Ethnographic Notes on Southern India
Living Experiences of Enlightenment
Geology of the Country Around - Polonnaruwa Reprint
Defence Expenditure in South Asia An Overview 1st Edition
Women in the Informal Sector
Life Under Milk Wood Women Workers in Rubber Plantations : An Overview
Excursions, Adventures, and Field-sports in Ceylon, its Commercial and Military Importance
Gender and Society Some Contemporary Issues
Post Beijing Reflections Women in Sri Lanka, 1995-2000 1st Edition
A Compendium of Indian Weed Science Research, 1950-1981
The Hybrid Island Culture Crossings and the Invention of Identity in Sri Lanka
Fazail-E-Amaal Vol. 1
Encyclopaedia of Chemistry
Encyclopaedia of Child Care Welfare and Guidance 2 Vols. 1st Edition
History of the Parsis Including Their Manners, Customs, Religion and Present Position 2 Vols. 1st Ed
History of the Rise of the Mahomedan Power in India Vol. 2
Encyclopaedia of Computer Software Technology 3 Vols. 1st Edition
Diagnosis and Treatment of Diseases in Ayurveda Based on Ayurveda Saukhyam of Todarananda Part 2 Rep
Encyclopaedia of Economic Planning and Development 5 Vols. 1st Edition
Dalits in India 2 Vols. 1st Edition
Principles and Perspectives Vol. 1
Cash Crops Vol. 6
French in India and Indian Nationalism, 1700 A.D.-1963 A.D. Vol. 2
Illustrated Encyclopaedia of World Knowledge
Quarterly Report of the Sri Lanka Labour Force Survey Third Quarter, 1999
Encyclopaedia of Health and Nutrition
The Lion's Roar Two Discourses of the Buddha from the Majjhima Nika
India-Bangladesh Relations Documents - 1971-2002 Vol. 1
C.W. Thamotharampillai, Tamil Revivalist : The Man Behind the Legend of Tamil Nationalism An Interna
Illustrated Dravyaguna Vijnana 5 Vols.
Manual of Geology 2 Vols. Reprint
Indian Geomorphology
Agricultural Crops and Livestock, 1993/94 Anuradhapura District - Preliminary Report
Economic Geography of the World
Indian Writings on Education, 1979 to 1986 An Indicator to Indian Educational Journals Grouped by 2
Modern Technology of Agro Processing and Agricultural Waste Products 1st Edition
Indian Philosophy Vol. 3 Reprint
Globalization and the Transformation of Planetary Rituals in Southern Sri Lanka
Indian Writings in English Vol. 8
Introducing Buddhism
Encyclopaedia of Investment Management 2 Vols. 1st Edition
Effective Collective Bargaining 2 Vols. 1st Edition
Encyclopaedia of Library and Information Technology for 21st Century 50 Vols. 1st Edition
Kannada Vol. 4 1st Published
Notes on the Great Indian Circus
Srngaraprakasa
Environmental Controversies
Martial Discord in Indian English Novel An Indepth Study of Major Contemporary Indian Novelists in E
Osama Bin Laden The Patron Saint of Terrorism
Ashab Al Kahf The Stunning Story of the Sleepers
Community and Identities Contemporary Discourses on Culture and Politics in India 1st Published
Agrarian System in Medieval India Land Revenue Arrangements in Sarkar Shahabad (Bihar), 1734-1790
2001 Census as Social Document 1st Edition
Atomic Energy and India's Nuclear Capability
Designing and Developing Organisations for Tomorrow 1st Published
Development Administration in an Indian State Guide Book Evolved for BDO in Orissa
Environmental Implications of Farmland Diversification 1st Edition
Bus Transport in India The Structure, Management and Performance of Road Transport Corporation
Come Evening : Carry Me Away (Poetry)
Dynamics of Public Enterprise Management
Ecological Problems of Developing Countries
An Essay on the Myth of the Rbhus 1st Edition
Industrial Exports and Developing Countries India Search for Countervailing Power
Minority Peoples in the Age of Nations States
Psycho-Analytic Concept of Religion
Regulated Market in a Rural Economy
Students, Teachers and Parents Academic Interaction in Education Setting
Submerging Villages Problems and Prospects
Chamba Himalaya Amazing Land, Unique Culture 1st Edition
Marriage Customs & Traditions of the World Reprint
Sai Baba An Encounter
The Company of Nobel Thoughts
Community Participation in Natural Resource Management 1st Edition
The Arab-Israeli Wars Indian Edition
Muslim Educational Thought in the Middle Ages
Raising Additional Resources in the States
Political Philosophy of the Sikh Gurus
Anthropology
Comparative Politics 2nd Revised & Enlarged Edition
The Plays of Eugene ONeill A Critical Study
Iqbal and the English Romantics
History of Ancient India Earliest Times to 1200 A.D.
Handbook of International Sources on Reference and Information 1st Edition
A Classical Dictionary of India
Write for Mathematics 2nd Edition
Outside the Circle A Video Story with Activities to Combat Racism and Prejudice for Young People Ag
Pragmatism 3 Vol. Set
A Practical Approach to Special Education for Every Teacher The 13 Book Collection
B.E.S.T. Buddies A Comprehensive Training Programme Introducing a Peer Buddy System to Support Stude
The Secret Princess
Canyon of Dreams The Magic and the Music of Laurel Canyon Illustrated Edition
Social Work Practice with Children and Families
Gerard Manley Hopkins
Human Rights Christians, Marxists, and Others in Dialogue
One Light Flash
English for Primary and Early Years Developing Subject Knowledge 2nd Edition
Creating Small Scale Social Programs Planning, Implementation, and Evaluation
Chip and Dip Lovers Cookbook
Pero Tafur Travels and Adventures 1435-1439
Fundamental Concepts of Inorganic Chemistry, Vol.3 2nd Edition
Writers on Organizations 6th Edition
Do Arrests and Restraining Orders Work?
Special Educational Needs A Guide for Inclusive Practice
The Housing Monster
Quality Improvement in European Public Services Concepts, Cases and Commentary
Applied Cross-Cultural Psychology
Deceptive Communication
The Upgrade
The Plural Self Multiplicity in Everyday Life
Engel : The Practice of Research in Social Work, 3 Editon + Holosko : Pocket Glossary for Commonly
Literature and the American College
Assumptions about Human Nature Implications for Researchers and Practitioners
A World of Giant Cities The Metropolis Era
J3 Crucible of Chaos
Media Literacy 6th Edition
The Catholic Milieu
The New Roget's Thesaurus Student Edition
Here on Earth
Poirot Investigates
Stardust of Yesterday
Hanging By a Thread
Letter from Home 1st edition
Odds Against
Bad Business
The Shadow of the Apocalypse
Delectable Mountains
Gemini
Dont Eat This Book Fast Food and the Supersizing of America
Mysteria
Aging Fight it with the Blood Type Diet
Demon's Delight
The Oxford New Italian Dictionary
Big Girls Dont Cry
Servant The Awakening
Dave Barry's History of the Millenn
Sweet Life
Sea Witch Children of the Sea, Book 1
Suite 606
Mona Lisa Blossoming
Seduced at Midnight
Witch Fury
Bone By Bone
Eggs Benedict Arnold
Guilty Until Proven Innocent
The Lost Throne
My Stolen Son: The Nick Markowitz Story
Assassin's Heart
The Judas Child
World-Class Ice Skater
Under Crescent and Cross The Jews in the Middle Ages
The Right Talk How Conservatives Transformed the Great Society into the Economic Society
Mammals of North America 2nd Edition
Hedge Funds An Analytic Perspective
Lili at Ballet (Paperstar Book)
George Washington's Breakfast
And America Attacked Monster of Terrorism in 21st Century 1st Edition
Globalisation and International Finance
Technological Change in Indian Irrigated Agriculture A Study of Water Saving Methods 1st Edition
Tales of the Sun or Folklore of Southern India 1st Edition
Early Buddhism Reprint London 1908 Edition
The Inhabitants of Asia The History of Existing and Extinct Nations, their Ethnology, Manners, and C
Joint Disorders Care in Ayurveda 2nd Edition
Library Database Management 1st Edition
Encyclopaedia of Natural History 6 Vols.
Encyclopaedia of Information and Library Science 10 Vols. 1st Edition
Tribal Cosmology, Myths, and World View Vol. 4
Market Regulation and Development
Women Poverty and Family Survival
Encyclopaedia of Animal Diseases 6 Vols. 1st Edition
Encyclopaedia of Applied Psychology 5 Vols. 1st Edition
Waders in Sri Lanka A Guide to Their Indentification and Study 1st Published
Graduate Employment in Sri Lanka in the 1990s
Perspectives on Language in Society : Papers in Memory of Prof. Srivastava 2 Vols.
Sacred Songs of India Vol. 7 1st Edition
Commonsense About Our Environment
Encyclopaedia of Environmental Water Pollution 3 Vols. Reprint
Low Volume Roads Construction and Maintenance A Working Manual 1st Edition
New Directions in Indian Psychology Social Psychology 1st Edition
Encyclopaedia of Sports, Health and Physical Education
Political Science Annual, 1997 Special Volume on India at 50
Life Bob Dylan Forever Young
Recruiting and Training Successful Substitute Teachers Participant's Notebook
The Legacy of Longevity Health and Health Care in Later Life
Angels in Vietnam Two Vietnam Novels From
Walsh, Introduction to Criminology : A Text Reader, 2 Edition + Pratt, Key Ideas in Criminology [BU
False Friends
Cumulative Student Activity Record of Clinical Experience for MSC Nursing Program (Log Book) As Per
Social Control and Political Order European Perspectives at the End of the Century
Knowing Feminisms On Academic Borders, Territories and Tribes
Leadership Theory and Practice 6th Edition
Courage to Remember
Jewish Identity in the Postmodern Age
African American Acculturation Deconstructing Race and Reviving Culture
Safe and Effective Gynecological Endoscopic Minimal Access Surgery 1st Edition
Radiology For Undergraduates and General Practitioners 1st Edition
Review in Oral Pathology with MCQs 1st Edition
Bangladesh - US Relations From Cooperation to Partnership 1st Edition
Training for Agriculture and Rural Development - 1997-98
Civilization of Love
Strange But True in Sikhism
Yoga for Health Curative Powers of Yogasanas Reprint Edition
Afghanistan Things Fall Apart - A Wordsmiths Compilation 1st Edition
Indian Poetesses From Vedic to Modern Times 1st Edition
Acheulian Culture in Peninsular India An Ecological Perspective 1st Published
The Hunchback of Notre - Dame Reprint
Man in Indian Tradition Vidyapati's Discourse on Purusa 1st
Rural Development and Population 1st Edition
US National Missile Defense Strategy Policy Documents 1st Edition
Office Organisation
The Kingdom of Afghanistan A Historical Sketch Reprint Bombay 1911 Edition
Wise and Wonderful The Animal Alphabet Quiz Book
Mathematics of Genome Analysis 1st Edition
Global Terror 1st Edition
Environment, 2001 A Global Challenge
Indian Books in Print, 1991 A Bibliography of Indian Books Published in English Language
Encyclopaedia of Project Management 2 Vols. 1st Edition
India and Tibet Vol. 6 1st Edition
Select Specimens of the Theatre of the Hindus Translated from Original Sanskrit Literature 2 Vols. R
Encyclopaedia of Technical Terms
History of Hindu Mathematics 2 Vols.
The Citrakarmasastra Ascribed to Manjusri Being Volume II of Vastuvidyasastra Vol. 2 1st Edition
Portuguese in India 2 Vols. 1st Edition
N.D. Basu's Criminal Court Handbook Containing Criminal Minor Acts
1941-1948 Vol. 2
Occidental Daughters of Mother India 3 Vols. 1st Edition
Sister Nivedita and Pondicherry Mother Vol. 3 1st Edition
Perspectives in Measurement and Evaluation of Education 5 Vols. 1st Edition
Encyclopaedia of Animal Physiology 13 Vols. 1st Edition
A Collection of the Inscriptions on Copper Plates and Stones in the Nellore Districts
Encyclopaedia of Value and Moral Education 5 Vols. 3rd Edition
Practice and Research in Literacy 1st Edition
Encyclopaedia of Physical Education and Sports Sciences
Encyclopaedia of Education and Culture in Free India 25 Vols. 1st Edition
Organic Chemistry Vol. 1 1st Edition
Cuddapah District Gazetteers Vol. 1 Reprint Madras 1915 edition
Culture Through the Ages Prof. B.N. Puri Felicitation Volume 1st Edition
Early Hindu India A Dynastic Study and Cultural History of Early Indian Civilization 3 Vols.
Handbook on Women and Human Rights A Guide for Social Activists 2 Vols.
Economic Development, Planning and Policy in India
Buffalo West Wing
Waking Nightmare
The Taking
Betsy Ross
The Man Who Disappeared
Primary and Elementary Education Policy and Programmes Growth and Development Organisation and Manag
Healing Mind, Body and Soul Reprint
How to Develop Profitable Listening Skills A Handbook for Developing Most Effective and Efficient Li
The Complete Guide to Modern Essays
The Sterling Book of Idioms
The Sterling Book of Concise Dictionary of English for Everyday Use
Snooker
A Crafty Session : Politician Jokes
Bottoms up with Drinking Jokes
India and East Asia Culture and Society
Chemistry : Objective Type Questions with Answers
Handbook of Research Methodology in History
Public Administration Concepts and Theories
Sex Expert Guidance from the Sexologist to Help You Spice up Your Love Life
Pregnancy
India On a New Threshold 1st Edition
Advanced Dictionary of Journalism 1st Edition
Mystery of Death of Subhash Chandra Bose
The Rebellious Rani of Belavadi and Other Stories 1st Edition
Rediscovering America American Studies in the New Century
Selected Tales from Arabian Nights Selected from the Original Sixteen Volumes of the Book of the Th
Problems in Physics For JEE-IIT and Equivalent Examinations Vol. 3
Semiotica Indica Encyclopaedic Dictionary of Body-Language in Indian Art and Culture 2 Vols. 1st Edi
1937-1996 Dissertations and Theses Vol. 2
The Early History of Islam 2 Vols. in 1
Encyclopaedic Dictionary of Genetics and Organic Evolution 3 Vols. 1st Edition
Prakrti The Integral Vision 5 Vols. 1st Published in India
Encyclopaedia of Women and Development 20 Vols. 1st Edition
Recent Advances in Plant Biology Dr. R.N. Kapil Felicitation Volume
Selected Works of Maulana Abul Kalam Azad
Text and Hindi Translation
The Complete Works of William Shakespeare Vol. 2 Reprint
Ourstory Indian Response to Nineteenth Century Literature 3 Vols.
Outlines of Indian Philology
Journey to the North of India Overland from England, Through Russia, Persia and Afghanistan Vol. 1 R
The Skanda Purana
Encyclopaedia of Food Science 3 Vols. 1st Edition
Encyclopaedia of Teaching of Economics 3 Vols. 1st Edition
Politics and the People In Search of Humane India
Social Transformation in India Essays in Honour of Professor I.P. Desai Vol. 1 1st Edition
Social Transformation in India Essays in Honour of Professor I.P. Desai Vol. 2 1st Edition
Various Political Parties Small Groups
Social Transformation in India Professor Madan Lal Sharma Felicitation Volume
A Miscellany Vol. 3
Encyclopaedia of the Universe : A Popular Work on the Marvels of the Heavens, the Earth, Plant, Lif
Patterns of Decentralised Governance in Rural India
Encyclopaedic Dictionary of Biological Sciences 6 Vols. Reprint
The Earth Has No Corners Felicitation Volume on the 70th Birthday of Dr. Karan Singh 1st Published i
The Narada-purana Part 1 1st Edition
Phonology and Morphophonemics
Papers in Language and Linguistics Vol. 2
The Gazetteer of Bombay City and Island 3 Vols. 1st Cosmo Print
Recent Advances in Plant Pathology
Personnel Management Theory and Practice
Proceedings of the Eleventh National Power Systems Conference NPSC - 2000
Researches in Indian Archaeology, Art, Architecture, Culture and Religion Prof. Vijayakanta Mishra
Socio-Economic Profile of Rural India 4 Vols. 1st Edition
Mandalas-6,7,8 Vol. 3 2nd Revised Edition
Patterns of Regional Geography An International Perspective 3 Vols.
Sri Ramachandrika Professor Oruganti Ramachandraiya Festschrift : Essays on Indian Archaeology, His
Reference Catalogue of Indian Books in print in English, Vol. 2 Author Index with a Directory of Pu
Wind Engineering Retrospect and Prospect
Societal Structure and Social Problems 3 Vols. 1st Edition
Lakshadweep
Theoretical Perspectives in Education
Papers in Language and Linguistics Vol. 1
Research in Social Sciences Professor Amreshwar Avasthi Felicitation Volume
Wondrous Whispers of Wisdom from Ancient India For Better Life-Management in the New Millennium
The Variegated Plumage Encounters with Indian Philosophy : A Commemoration Volume in Honour of Pandi
Working Women and Children 6 Vols. 1st Edition
A History of the Great Revolt 3 Vols. Reprint
Rama in Indian Literature, Art and Thought 2 Vols. 1st Edition
Hall of Fame and Plant Pathology
World Trade Organisation Text Vol. 2
Rambles and Recollections of an Indian Official Vol. 2 Reprint Westminster 1893 Edition
Travels in South-Eastern Asia Embracing Hindustan, Malaya, Siam and China with Notices of Numerous M
Vishnudharmottara Purana Translated into English from Original Sanskrit Text 3 Vols. 1st Edition
Visvambhara Probings in Orientology : Prof. V.S. Pathak Festschrift
Western Political Thought From Bentham to Present Day Vol. 2
Trends in Biomembranes and Bioenergetics, Vol. 1
Travels in Tartary, Thibet and China During the Years, 1844-1846 Vol. 1 Reprint London 1851 Edition
World's Greatest Socialist Thinkers 25 Vols. 1st Edition
Trends in Chemical Engineering
Trends in Chemical Physics, Vol. 8
Readings in Financial Management 4 Vols.
Aspects of Environment and Resource Ecology of Garhwal
Structures of Significations
The Book of the Forest Vol. 3 Reprint
Recent Advances in Entomology 10 Vols. 1st Edition
Tribal Languages of Ladakh
Readings in the Indian Parliamentary Opposition 2 Vols. 1st Edition
Readings on Information Technology 2 Vols. 1st Edition
Tribes and Tribal Life 3 Vols.
The Later Mughals Vol. I : 1707-1720, Vol. II : 1719-1739 2 Vols. in 1 Reprint
Trends in Chemical Physics, Vol. 4
Women in Contemporary Indian Society 2 Vols.
Its Validity and Its Sources Vol. 1 1st Edition
Canto Ten, Chapters 1 to 4 Vol. 1 1st Edition
The Indian Precambrian A Volume in Honour of Professor Ashit Baran Roy 1st Edition
The Ancient History of the World
Aranya-Kanda, Kishkindha-Kanda, Sundara-Kanda Vol. 2
World Labour Report 1993-94, Vol. 6 & 7 Reprint
English Translation of Adhyaya One with Sanskrit Text, Transliteration, Word-Boundary, Anuvrtti, Vrt
Third World Sociology 2 Vols. 1st Edition
Studies in Tribal, Rural and Urban Development 2 Vols. 1st Edition
The Standard Cyclopaedia of Modern Agriculture and Rural Economy 12 Vols. 1st Edition
Top Cops Biographies of World's Top Policem
Sumati-Sangitabharanam = Gems of Indian Music and Musicology Prof. Sumati Mutatkar Felicitation Volu
Introductory Microbiology
Essentials of Tuberculosis in Children 1st Edition
Understanding Medical Physiology A Textbook for Medical Students
Perceptional Cartography and District Planning
Growth, Stability and Equity in Agriculture A Quantitative Analysis 1st Edition
Personality Issues in Assessment and the Projective Inventory Approach 1st Edition
Private Development Aid in Transition
Atlas of the Child in India
Commercial Geography of a Metropolitan City Spatial Structure of Retailing in Bombay 1st Published
Developmental Migration A Processual Analysis of Inter-State Rural : Rural Migration
Dynamics of Development in Gujarat 1st Edition
Geography of Marketing and Commercial Activities in India Documentation on Research Information (CI
Geography of Plants The Uses of Principal Cultivated Plants on which the Prosperity of Nations is B
Poverty in Metropolitian Cities
Regional Perspectives in Agricultural Development A Case Study of Wheat and Rice in Selected Region
Residential Pattern of Suburbs
Pharmaceutical Biotechnology
Advanced Learner's Dictionary of Accounting 1st Edition
Environmental Pollution and Agriculture
Development of Citizenship Habits Among Indigenous People 1st Edition
Vedanta and Future of Mankind
Ten Short Stories by Suresh Joshi English Translation of Gujarati Short Stories 1st Edition
Physical Organic Chemistry 1st Edition
Pioneers in Scientific Discoveries 1st Edition
Sleep-wakefulness 1st Edition
Buddhanusmrti A Glossary of Buddhist Terms 1st Edition
Cookery Wizard 1st Edition
Corporate Strategies New Age Weapons for Excellence
Distance Open Learning Challenges to Developing Countries 1st Published in India
Relaxation for Health and Success Stress Reducing Techniques for Confidence and Positive Health 2nd
In The Name of Child Labour Eradication and Evaluation Programme 1st Edition
Knowledge Management in Libraries
Namamala Ã’r a Work on Pali Grammar
Urban Development and Management 1st Edition
Armageddon : The Battler in the Heaven Between Good and Evil and other Poetic Pearls 1st Edition
The Cambridge Illustrated History Religions
Performance Appraisal of Mutual Funds in India
Managing Global Competitiveness : What Indian Companies Must Do 1st Edition
The Dancing Biography and Shovana Narayan
Indian Prime Ministership A Comprehensive Study 1st Edition
Methods in Biotechnology and Bioengineering For Pharmacy and Other Biosciences 1st Edition
Elements of Biblical Ethics
Ethics on Health Care A Critique
Global Research on Drainage in Agriculture An Annotated Bibliography, 1960-1986
Television in Kheda : A Social Evalution of SITE
Planning for Forest Resources and Bio-Diversity Management Principles, Organization and Methodology
Law and Practice of Character and Integrity Rolls 2nd Edition
Central Administrative Tribunal Digest, 1995-1996
Commentaries on Mental Health Act, 1987 With Supplement
How to Become An Immigrant to Canada and the United States of America
Immoral Traffic (Prevention) Act, 1956 4th Edition, With Supplement
Swaraj : The Problem of India
Crime : Its Cause and Treatment
Distribution of Refinery Products in India
Cultural and Structural Dimensions of Family : A Study of Jalari Fishermen
Faith Possesses Understanding : A Suggestion for A New Direction in Retional Theology
Numbers Their Iconographic Consideration in Buddhist and Hindu Practices 1st Published
Information Management in Government
The Loneliness of a Long Distant Future Dilemmas of Contemporary Architecture 1st Published
Indian Defence Yearbook - 2002
Partition and Genocide Manifestation of Violence in Punjab, 1937-1947
Mathematics Enjoyment for the Millions Second Revised Edition Enlarged with 50 Brain Sharpeners and
Lifelong Education 1st Edition
Economics, Planning and Public Administration
Price Levels and Economic Growth
Studies in Capital Formation, Saving and Investment in a Developing Economy
Philosophy of Sex
Salads and Raitas Fiesta
Legendary Biju The Man and Mission 1st Edition
Aesthetics of Indian Folk Dance
The Malayalese The People, Their History, and Culture 5 Vols. 1st Edition
Encyclopaedic Dictionary of Literary Terms 2 Vols. 1st Edition
The Akbar Nama of Abul-L-Fazl Translated from the Persian Vol. 3
Total Quality Management 3 Vols.
The Cambridge World History of Food 2 Vols.
The Masterpiece Library of Short Stories 20 Vols.
The Treatise on Indian Medicinal Plants Vol. 4 Reprint
Books VIII, IX and X Vol. 4 Reprint
The Selected Novels
The Witings of Kwang-3Ze, Books XVIII-XXXIII, the Thai-Shang Tractate of Actions and Their Retributi
United Nations on Human Rights 2 Vols. 1st Edition
Encyclopaedia of Political Parties India, Pakistan, Bangladesh - National, Regional, Local
India and her Problems
Information Technology Applications in Libraries 1st Edition
Infomedia in Higher Education 1st Edition
Bharat's Supreme Court on Direct Taxes, 1950-1998 With Case Review
Company Law Digest, 1913-1993 With English Cases and Judicial Analysis 2 Vols.
Recent Advances in Medicinal, Aromatic, and Spice Crops International Conference Held on 28-31, Jan
Tropical Sketches, or, Reminiscences of an Indian Journalist 2 Vols. Reprint London, 1855 Edition
The Paradoxes of Partition (1937-47) 1937-39 Vol. 1 1st Edition
Agricultural Terminology 1st Edition
Uncommons in the Commons Community Initiated Forest Reourse Management : With Botanical Input 1st Pu
Constitutional Reforms Problems, Prospects and Perspectives 2nd Edition
Seers, Deities and Metres in Vedas 1st Edition
K.P. Chakravarti's Words and Phrases Under the Constitution of Indi
Vedanta-Chandamrita, (Prasthanatrayi Se Cayana) : The Vedanta Verses : An Annotative Anthology of th
Political Thinkers of the World 2 Vols.
Katha, Prize Stories, Volume 9
Treatise on FERA (Law and Practice) : A Commentary on the Foreign Exchange Regulation Act, 1973 : wi
Triratna Heritage, Governance and Equity : Honble Shri T.N. Chaturvedi Festschrift 5 Vols. 1st Edit
Financial Management in Development Banks 1st Edition
Life and Works of Booker Prize Winners 1st Edition
Education and Society 1st Edition
Grassroots Economics The Poverty of Agricultural Labourers 1st Edition
Major Constitutions Government and Politics in U.K., U.S.A., Switzerland and China 2 Vols. 1st Editi
Preschool Education & An Intergrated Preschool Curriculum 1st Edition
A Textbook of Algae 1st Edition
Chordate Embryology 1st Edition
The Tabaqat-I-Akbari of Khwajah Nizamuddin Ahmad A History of India from the Early Musalman Invasion
The Travels of Pietro Della Valle in India [From the Old English Translation of 1664, by G. Havers]
The Gospel of Love : Glimpses of 'sri Ram
The Jataka, or Stories of the Buddha's Former Births Vol. 4 Reprint Cambrid
Manasollasa and Ayurveda 1st Edition
Commercial Banking 1st Edition
Srimad Bhagavadgita Rahasya or Karma-Yoga-Sastra
Reference Manual for UGC Examinations NET, SLET, JRF and other UPSC Competitive Tests : Economics 1s
Mass Communication Theory and Practice in the 21st Century 1st Edition
International Ecotourism Environmental Rules and Regulations 1st Edition
Educating the Nation Documents on the Discourse of National Educational of India, 1880-1920 1st Publ
Bodhisattva and Sunyata In the Early and Developed Buddhist Traditions 1st Edition
Yoga-Nidra : Yogic Trance Theory, Practice and Applications 1st Published
Architecture of Bhoslas of Nagpur 2 Vols. 1st Edition
The Sorcerer-King and the "Great Abortion&a
Himalayan Snow and Glaciers Associated Environmental Problems, Progress and Prospects 1st Published
Problems of Primary School Drop-Outs 1st Edition
Creativity in Student Teachers
Educational Philosophic Beliefs 1st Edition
Methods of Teaching Educational Technology 1st Edition
Methods of Teaching Civics 1st Edition
Methods of Teaching Commerce 1st Edition
Plural Identities and Political Choices of the Muslim Community
Forgotten Identities Women Artisans of Kashmir 1st Edition
Transformative Organizations A Global Perspective 1st Edition
Advertising Basics! A Resource Guide for Beginners 6th Printing
Paradigms of Learning The Total Literacy Campaign in India 1st Published
Livestock Epigenetics
Guided Waves in Structures for SHM The Time - Domain Spectral Element Method
MCQs in Periodontology with Explanation
All Creation Groans with Pain
Tiny the Snow Dog Export Edition
Materials on European Criminal Law
Quest Intro Level Reading and Writing EZ Test CD-ROM
Blue-Blooded Vamp
Clinical Microbiology Made Ridiculously Simple 4th Edition
Mastering Orthopedic Techniques Spine Surgery 1st Edition
The Ultimate Why Question Why Is There Anything at All Rather than Nothing Whatsoever?
Sure Success in BDS IV Year, Vol. 1
Nightshade City Book I OF The NightshadeChronicles
Trucks and Diggers
Select Works of Sri Sankaracharya Sanskrit Text and English Tranlation 1st Cosmo Print
Peasant Movements in Post-Colonial India Dynamics of Mobilization and Identity 1st Edition
Sociology of Religion in India 1st Edition
Reforming Secondary Education 1st Edition
Bangladesh Road to Sustainable Development People's Voice
Symbol, Script and Writing (From Petrogram to Printing and Further) 1st Edition
The Markandeya-Puranam Indroduction, Sanskrit Text English Translation with Notes and Index of Verse
Islamic Architecture of Deccan (With Special Emphasis on Rayalaseema Region) 1st Published
Sociological Foundations of Education 1st Edition
Ancient Indian Surgery Based On Susruta Samhita
The Light of the Upanisads 1st Edition
Environmental Approach in Geography Teaching 1st Edition
Buddhist Philosophy of Social Activism 1st Edition
Buddhist Tantricism 1st Edition
Theory of Social Leadership 1st Edition
Vikramorvasiyam = Urvashi and Pururavas Global Paperback Edition
Dhammapadapali and Suttanipata, (Dhammapadapali evam Suttanipata), Vol. 10 Pali Text With English T
Mother Divine : The Supreme Being Meditation on the Vision of Eternal Presence : An Exposition of Pe
Gender Related Problems of Women, Women's Empowerment and Panchayati Raj 1st Edition
Law of Electricity in India : As Amended by the Electricity Laws (Amendment) Act, 1998 (Act No. 22
Mitra on Hindu Law 3rd Edition, Reprint
Insights into the Mongolian Crescent of India
The Untouchables Subordination, Poverty and the State in Modern India 1st Edition
Indian Vegetable Culture for Hills and Plains
Gentlemen Poets in Colonial Bengal Emergent Nationalism and the Orientalist Project 1st Edition
Keeping The Air Clean (The Junior Library of Ecology)
TQM in the Service Sector Reprint
Social Philosophy of the Mahabharata and Manusmriti
Breeding in Crop Plants Mutations and in Vitro Mutation Breeding 1st Edition, Reprint
Litchi Botany, Production and Utilization 1st Edition
Seed Science and Technology
A Gospels Encyclopaedia 1st Edition
Geriatrics in Ayurveda 1st Edition
Child Care in Ancient India from the Perspectives of Developmental Psychology and Paediatrics 1st Ed
Frontiers in Fungal Biotechnology and Plant Pathogen Relations Proceedings of the Conference Held f
At Every Breat - A Teaching : Stories About The Life and Teaching of Swami Chinmayananda
Suravaram Pratapa Reddy Telugu Writer
Synergising HRD Interventions Challenges and Initiatives
A Guide to Educating Children With Learning Disabilities 1st Edition
Wordoodles Poems
The Seven-Walled Fort and Other Poems 1st Edition
Existence 2nd Edition
Paging the Unknown
Industrial Pollution Technologies for Abatement and Control
Economic Analysis of Environmental Problems in Tanneries and Textile Bleaching and Dyeing Units and
Lal's Commentaries on Water and Air Pollution and Environment (Protection) Laws Along with
Three Nes-Pas or Tridosa Vijnana (Chapters I to IV of Man-nag Rgyud or Upadesa-tantra or the text on
Selected Works of Maulana Abul Kalam Azad, 1943-46 Vol. 2
Selected Works of Maulana Abul Kalam Azad Vol. 9
Oriental Numismatic Studies Vol. 2 1st Edition
Origin & Development of Legal &a
Encyclopaedia of World Women 10 Vols.
Principles and Theory of Political Science Vol. 2
Encyclopaedia of the Indian Biography 8 Vols.
The Foundation of Muslim Nationalism Vol. 1
Small Scale Industries
Recent Trends in Chordates 6 Vols. 1st Edition
The Farmers Encyclopaedia and Dictionary of Rural Development
Socio-Economic Survey of Bhilai Region Part 1
Rediscovering India India's Philosophy Library 71 Vols.
The Forgotten Monuments of Orissa Vol. 2
Himachal Pradesh
South Indian Inscriptions
Rhymes Through Prayer, Praise and Song
Heteropters
String Theory
Samadhipada Vol. 1
Recent Advances in Embryology 5 Vols. 1st Edition
The Masnavi 2 Vols. 1st Edition
Introduction Vol. 1 1st Edition
The New Gresham Encyclopaedia of the World 12 Vols.
Taxmann's Companies Act as Amendment by Companies (
The Pakistan Gazetteer 7 Vols.
Teaching Tribals Through Gramsevak and Voluntary Agency
Unknown Soldier and Other Poems 1st Edition
Our Freedom Struggle : 1857-1947 1st Edition
Coalition Politics The Indian Experience 1st Edition
Tradition and Transmission Current Trends in French Ethnology : The Relevance for India 1st Edition
Encyclopaedia of Educational Technology 4 Vols. 1st Edition
Sports Medicine and Management A Practical Approach 2 Vols. 1st Edition
Kevala-Bodhi Buddhist and Jaina History of the Deccan (The BSL Commemorative Volume) 2 Vols. 1st Edi
Theories of Education and Education in the Emerging Indian Society 2 Vols. 1st Edition
The Latest Portfolio of Theory & Practice in Gymnosperm 1st Edition
Trans-Himalaya Discoveries and Adventures in Tibet 3 Vols. Indian Edition
In an Eastern Rose Garden Vol. 7 Reprint
Problems of Educational Backwardness 1st Edition
War on Poverty For Taking Poor to Portals of Civil Life 1st Edition
Learn to Play on Flute Including Shahnai, Been and Piccolo 33rd Edition
International Dimension of the Sri Lankan Conflict Threat and Response
The Indian Annual Register A Digest of Public Affairs of India Regarding the Nation&
Orchid Culture in Ceylon and the East Reprint Colombo 1918 Edition
The Architecture of Knowledge Quantum Mechanics, Neuroscience, Computers and Consiousness 1st Editio
Think Before Getting Grey 1st Edition
Theory and Applications of Microeconomics
The Variation of Animals and Plants Under Domestication With Illustration 2 Vols.
Pondicherry 1st Published
Malavikagnimitram Malavika and Agnimitra
The Story of My Heart My Autobiography
Medicinal Plants New Vistas of Research Vol. 1
The Great Gurus of the Sikhs 6 Vols. 1st Edition
Educational Technology Knowledge Assessment 1st Edition, Reprint
Rabindranath Tagore Images of Women: Selected Poems 1st Edition
Sharadatilakatantram - Part I Vol. 10
Among the Temples of China 1st Edition
Fiction Vol. 2 2nd Revised & Enlarged Edition
A Textbook of Environmental Science 1st Edition
The Dynamic Geosphere Professor William Sefton Fyfe Felicitation Volume
The Questions of King Milinda Vol. 2 Reprint
Advanced Learner's Dictionary of Information Technology 1st Edi
The Giant Awakens Punjab Industry and Growth 1st Edition
The Caraka Samhita 5 Vols. 2nd Revised and Enlarged Edition
Operative Considerations in Ancient Indian Surgery Based on Chapters Samhita, Cikitsa-Sthana, Chapte
Indigenous Characteristics of Mughal Architecture 1st Published
Become a High Achiever
A Peep into Yaksagana and Sanskrit Dramaturgy
Development of Women An Assessment 1st Edition
Economic Reforms Sans Development
How the Brain Got Language The Mirror System Hypothesis
A Quiet Revolution The Veil&
Formation and Properties of Clay-Polymer Complexes 2nd Illustrated Edition
Chicano Discourse Socio-historic Perspectives
The Rational Good A Study in the Logic of Practice 1st Indian Edition
Nyayadarsana of Gotama Text, Vatsayayana Commentary and English Translation 8 Vols.
School Organisation 1st Edition
The Northeast Complexities and its Determinants 1st Edition
Psychology of Learning and Development Development of Learning and Teaching-Learning Process 1st Edi
Education, Polity and Society A Study of Education and Democratic Consciousness 1st Edition, Reprint
Hindu Nationalism and Democracy 1st Edition, Reprint
Adult Education in India Some Reflections 1st Edition
Understanding the Social Sphere The Village and Beyond
India and Australasia History, Culture and Society 1st Edition
Development, Gender and Diaspora Context of Globalisation
Ancient and Medieval Nepal 1st Paperback Edition
Brahma-Sutras Sanskrit Text, English Translation, Commentary and Notes 2 Vols. 1st Edition
Methods of Teaching Computer Science 1st Edition
Fish Ponds For The Farms Reprint
Revealing Advaita Vedant 8 Vols. 1st Edition
Investigating Social Capital Comparative Perspectives on Civil Society, Participation and Governance
Arun Joshi's Novels A Critical Study 1st Edition
Albert Einstein Selected Writings
Miyazawa Kenji's Ten Japanese Stories for Children 1st Published
Providing Education for All
Women in India Retrospect and Prospect
Tropical, Subtropical Fruits and Flowers Cultivation
Swami Ram The Poet Monk of the Punjab
Introduction Vol. 1 2nd Revised and Enlarged Edition
Devyagama Vol. 5 2nd Revised and Enlarged Edition
Ancient Tales of Wit, Wisdom and Humour The Best of Mulla Nasruddin, Tenali Rama, Appaji Rao and Ma
Modern Theories of Library Cataloguing
The Other Indians Essays on Pastoralists and Prehistoric Tribal People
The Problems of Work
Genetic Diversity and Food Security
Motivational Analysis in Music and Dance
Text Book of Vector Dynamics 1st Published
Life of Buddha
Tourism and Biodiversity
Physical Education, Fitness and Sports
Studies in Literature in English Vol. 2 1st Edition
Encyclopaedia of Modern Educational Technology 3 Vols.
Encyclopaedic Ethnography of the Himalayan Tribes 4 Vols. 1st Edition
Priyadarsika 1st Edition
Resource Transfer and Debt Trap
Principles of Fruit Preservation 1st Edition
Encyclopaedic Dictionary of Economics
The Indian State After Independence
Administrative Reforms and Orissa's Development
The Comptroller and Auditor General of India An Analytical History, 1947-1989
Ayurveda, the Science of Living Health and Vigour Forever 1st Edition
RA-Sakyamitra Vol. 10 1st Edition
Pervasive Terms Vyapti Vol. 1 2nd Revised Edition
Role of Voluntary Organisations in Tribal Development
Energy, Ecology and Environment A Technological Approach 1st Edition
Agricultural Marketing in India The Case of Regulated Agricultural Markets in Uttar Pradesh, 1998-99
Azadirachta Indica A. Juss, Syn. Melia Azadirachta Linn, Neem, Family Meliaceae
Indian Economy and Socio-Economic Transformation Emerging Issues and Problems : Essays in Honour of
Carbon and Carbon Materials Recent Trends : Indo Carbon 2003 : Conference Proceedings 1st Edition
Information Technology in Libraries 1st Edition
Agriculture and WTO Opportunity for India 1st Edition
Beekeeping For Profit and Pleasure Indian Reprint
Indian Constitution
Solomon's Saga of a Wild Life Sanctuary Veerangana Durgavati Ab
Gendered Realities, Human Spaces The Writing of Shashi Deshpande 1st Edition
A Killer in Kailash 1st Published
Blue Gold The Fight to Stop the Corporate Theft of the World's Water Reprint
The Beginner's Cook Book Eggs 1st Edition
Conservation, Displacement, and Deprivation Maldhari of Gir Forest of Gujarat
Century of Light Bahai World Centre 2nd Edition
Indian Diaspora in Asian and Pacific Regions Culture, People, Interactions 1st Edition
Death
E-Governance A Choice to Upgrade India's Rural Economy
Electronic Principles Applications and Devices
Dictionary of Alternative Meaning
Dictionary of Idoms (i.e. Idioms) and Pharases (i.e. Phrases) 1st Edition
Emotional Freedom Techniques Revised Edition, Reprint
Crimes in Cyber Space Scams and Frauds : Issues and Remedies
Manuring for Higher Crop Production Reprint
Diagnostic Radiology and Imaging
Loricata Testudines Vol. 1 2nd Edition
Sauria Vol. 2 2nd Edition
Everyday Entrepreneurs The Harbingers of Prosperity and the Creators of Jobs
Sucheta Kripalani Great Women of Modern India
Feeling The Philosophy of Bhagavad Gita 1st Edition
Feminism in India Issues in Contemporary Indian Feminism 1st Edition
India's National Security Annual Review, 20
Distance Learning Technologies in Education 1st Edition
10 Essential Foods A Sensible, Good-Humored Approach to Vitality, Health, and Well-Being Reprint
History of Anthropology Revised Edition
Folk Dances of Chamba Where Every Talk is a 'song and E
Library and Information Profession in India Dr. P.S.G. Kumar festschrift
International Finance and Global Macroeconomics
International Mediation in the Inter Ethnic Conflict in Eastern Europe 1st Edition
Selected Punjabi Short Stories 1st Edition
Indian Democracy and Governance Essays in Honour of Professor R.N. Pal 1st Edition
Recent Trends in Manufacturing CARTM-2003, November 14-15, 2003
Re-Engineering Library and Information Services Process, People and Technology
Gandhian Alternative to Contemporary Problems 1st Edition
Resources Management for Sustainable Development 1st Edition
Road to Brand Equity 1st Edition
Gita Today 1st Edition
Sahni's Hindi-English Dictionary With Illustrations Hindi-Angreji Sabdakosa
Differing Interpretations of the Torah in Matthew's Gospel A Narrative-Crit
Hospital Supportive Services Hospital Administration in the 21st Century 1st Edition
Integrated Child Development Services A Study of Job Performance of Supervisors
Morphogenesis
Prehistoric Life 1st Edition
Foreign Trade and The World Trade Organisation 1st Edition
Economics of Tourism and Development 1st Edition
Information Management
Health Education 1st Edition
India Book of the Year, 2004 Events of December, 2002 to November, 2003
Security and Diplomacy Essential Documents 1st Edition
Science of Hypnosis 2nd Reprint
Sitar and Its Compositions 1st Edition
Shamsur Rahman A Witness of his Times 2nd Edition
Sins of My Youth
Disparities in ICT Access and Use
Evolution of Information and Communication Technologies
Smoking Cigarettes The Unfiltered Truth Understanding Why and How to Quit
Some Aspects of Agricultural Credit in a Developing Economy 1st Edition
Spiritual Culture of India and Other Essays 1st Edition
The Political and Statistical, History of Gujarat Translated from the Persian of Ali Mohammed Khan,
Paediatric and Gynaecological Considerations and Aphorisms in Ancient Indian Surgery Based on Chapte
Desert in Bloom Contemporary Indian Women's Fiction in English 1st Edition
Taxmann's Master Guide to Income Tax Act With Commentary on
Harvest of Hatred The Concerned Citizens Tribunal Report on Gujarat, 2002
Hercolubus or Red Planet 1st Indian Edition
Inscriptions of the Vijayanagara Rulers Inscriptions of the Rulers of the Sangama Dynasty, 1336 A.D.
The Potato Production and Utilization in Sub-Tropics
The Quality Assurance Manual
Jainism and Indian Civilization 1st Published
The New Wine-Skins The Story of the Indigenous Missions in Coastal Andhra Pradesh, India
Judicial Activism and Accountability
Kamalahasan The Consummate Actor
Trade Union as a Social Institution of Change Korea
Traditional Exports of India Performance and Prospects
Spirituality
A-Z of Law in Management 1st Edition
Textbook of Information Technology 1st Edition
Local Government Rural and Urban : For UGC-NET, M.A., UPSC and State Public Service Commission Exam
Terrorism in South Asia Views From India 1st Edition
Mainstreaming Micro Finance
Women in India Problems and Prospects
World Trade and Development Report, 2003 Cancun and Beyond
The Primacy of the Political
The Private Lives of World Famous People
End of Life Issues
Nuri Granth The Sacred Songs of Sadhu T.L. Vaswani (Nuri)
Islam and Peace in the 21st Century
The Science of Infant Feeding
Modern Dictionary of Eco-Environment
Modern Teaching of History Strictly According to the UGC Syllabus For B.Ed. Course
Money, Banking and Public Finance Based on UGC Model Curriculum : 2002 For B.A. (Pass/Hons.) Econom
Performance Banking and Rural Development
Mother-Goddesses in Kathmandu
Jammu and Kashmir
Ritual and the Quest for Truth
Poverty Among Scheduled Castes A Study
Manusmrti With the Sanskrit Commentary Manvartha-Muktavati of Kulluka Bhatta
Principles of Teaching in Elementary Schools
The Archaeology of Middle Ganga Plain New Perspectives (Excavations at Agiabir) 1st Edition
Transition Towards Sustainable Development in South Asia
Terror on the High Seas 1st Edition
Law of Contempt of Court in India
Feminine Sensibility in the Novels of Margaret Drabble An Interpretation and Evaluation
Letters for All Occasions
Hand Book on Ayurvedic Medicines With Formulae, Processes and Their Uses
Hand Book on Spices
Indian Estuaries
Babur the Tiger
War in Iraq and New World Order
Decision Support System
Issues in Digital Cataloguing
Existential Authenticity An Examination
Miracles in Our Bodies
Handbook of Environment
Participatory Learning & Action
Recent Trends in Power Management
Social Security in a Developing World Context
The Trodden Path Essays on Regional and Micro-Level Planning
Women and Child Education 1st Edition
Tourism Strategies for Rural Development
Winning Amidst Unexpected Unknowns
Managing Information, Knowledge and Power in the Cyber Age Essays in Honour of Prof. R.G. Prasher
Memoirs of My Indonesian Lecture Tour
India in Sri Lanka Between Lion and the Tigers
I Am Sorry (IAS) Indian Bureaucracy at Crossroads
Experimental Psychology with Advanced Experiments
North East India Assam, Manipur, Tripura, Nagaland
Healthcare and Nursing Family
Anarchism A Political Reader
Global Justice Liberation and Socialism
Guide for Obesity Diabetes Hypertension and Other Cardiac Problems
My Amazing India Daybook
New World Economy Changing Dimensions of Commerce Clause : Internet as Instrumentality of Commerce
Tax Incentives and Economic Growth An International Comparison UK, USA, France, Japan, Singapore,
The Novels of Rohinton Mistry A Critical Study
British Lions and Indian Tigers
Anthelmintics and Antimycotics
Heterocyclic Chemistry
Educational Environment A Key to Effective Teaching
Daughter of the Mountains
Handbook of Alternative Therapies
Hinduism Rediscovering the Mystical
Recent Advances in Natural Language Processing Proceedings of the International Conference on Natur
History and Organisation of Indian Police
Cops Code of Conduct
Contemporary South Asia
Manpower Profile India, Yearbook, 2003
Teachings of Mahabharata
Spices, Vol. 1 Traditional Uses &
The Curse of the Goddess 1st Published
Inquiry into the Nature of Moral Principles
Plates XV-CLXIV
Laws Relating to Cooperative Societies A Commentary
Southeast Asian Crisis An Economic Analysis
A Textbook of Special Education
Experimental Biotechnology
A Textbook of Teacher Education
Love Management
Advances in Horticulture and Forestry, Volume 2, 1992
Narrative Construction of India Forster, Nehru and Rushdie
Layout and Marking in Track and Field
State of the Indian Farmer A Millennium Study 27 Vols. 1st Edition
Teaching of Mathematics New Trends and Innovations
Teaching of Economics New Trends and Innovations
A Symposium on Fish Culture A Practical and Comprehensive guide on Inland Fish Farming
Development of Destitute Tribal Communities
Historiography and Historians of Modern India
Analysis of Milk and its Products A Lab Manual 2nd Edition
Abridged Version
Rural Development and Education
India and SAARC Engagements
Dimensions of Women Exploitation
Child Counselling and Education
Role of NGOs in Development of Social System
Encyclopaedia of Ecology, Environment and Pollution Documents and Case Studies
Sufism in India
Hatha-Yoga Its Context, Theory and Practice 1st Edition
Voyages and Travels into Brazil and the East Indies Containing an Exact Description of the Dutch Br
Democratic Administration and Education
Foundations of External Quality Assurance in Indian Higher Education
New Assignment in Journalism
The Marcandeya Purana In The Original Sanskrit
Horticultural Development in Hills A Case for the Alaknanda Basin, Uttaranchal
Dalit, Racism and Social Articulation
Minorities and Social Conflict
Indian Constitution, Government and Politics
The Voyage of Francois Pyrard of Laval To the East Indies, The Maladives The Moluccas and Brazil 2 V
In the Wonderland of Investment Assessment Year 2004-2005
The Banishment of Seeta
Scenario of Agriculture in Andhra Pradesh
Saga of Energy, Mind and Numerology
State Politics and Panchayats in India
Bangladesh Army and Contemporary Issues
Bangladesh Society and Change
Intellectuals and Society A Study of Teachers in India
The Upasana-cintamani Wish-Yielding Gem of Meditation
Know Your India
Rural Development in India Approaches and Applications
Mutual Funds In India
Communication and Education for Health Promotion and Population Regulation A Global Perspective
Increasing Role of Technology in Education
Politicisation Of Indian Education
Multicultural Education
The Power of Innovative Thinking Let New Ideas Lead You to Success
India's Elderly A Multidisciplinary Dimension
India Related Naipaul A Study in Art
Maratha Military Systems
Problems of Research in Public Administration
Rural Development Through Cooperatives
Role Conflict Among Women Teachers
Indian Military Legal Systems
Textbook of Inorganic Chemistry
Sustainable Rural Development for Disaster Mitigation
Women Empowerment and Gender Planning
Economic Environment of Business
Elementary Education in 21st Century
Diplomatic Journey Emerging India
Dictionary of Common English
Discover India
Music Information Retrieval
Tribal Villages in Arunachal Pradesh Changing Human Interface
Great Sufi Saints Sarmad and Bawa Muhaiyaddeen
Cosmo Dictionary of Mathematics
The Place of Aphorisms Vol. 1 2nd Revised and Enlarged Edition
Abdul Hameed Ansari Revolutionary Journalist and Freedom Fighter
Environmental Crisis and Techno-Economic Alternatives
Indian Kavya Literature
Changing Trends in Strategic Management
Economics of Floriculture
Globalisation or Colonisation?
Factions in Northern Rural India
The Failure of Lord Cuzon A Study in "Imperialism&a
The Clash of Ideologies Middle Eastern Politics and American Security
Archbold Criminal Pleading, Evidence and Practice 2012 60th Edition, Full Print + Supplements
The Works of Alain Locke
The Oxford Handbook of Thomas Middleton
A Tale of Things Timeless
Political Alienation in Libya Assessing Citizens Political Attitude and Behaviour
Eve Templar 1
Thief of Shadows
God With Us
To the Last Breath A Memoir of Going to Extremes Illustrated Edition
Shakespeare in America
On Oligarchy Ancient Lessons for Global Politics
Breaking Ice for Arctic Oil The Epic Voyage of the SS Manhattan Through the Northwest Passage
Polanski and Perception The Psychology of Seeing and the Cinema of Roman Polanski
The Emotional Wellness Way to Cardiac Health How Letting Go of Depression, Anxiety &
Getting Children Back to School Case Studies in Primary Education 1st Edition
The Invincible Deadly Mosquitoes
Jaina Worship and Rituals Ancient and Medieval India
Governance in India A Theatre of the Absurd
Indian Constitution Government and Political System
Organic Compounds
Organic Synthesis
Vision of Raja Rammohun Roy Secularism, Humanism, Universalism
Water and Waste Water Management
Indian Ocean Rim-Association for Regional Cooperation Problems and Prospects 1st Edition
Environmental Security Concept and Dimensions
Administration and Management of NGOs Text and Case Studies
Management of State Tourism Development Corporations
Moulds Design and Processing Hand Book The Book Covers Complete Details of Mould Design and Processi
Guide to Wellness and Well-Being
Paint Varnish Solvents and Coating Technology 2nd Edition
Hand Book of Adhesives With Their Formulaes : With Directory of Manufacturers/Suppliers of Plant, Eq
A Personal Narrative of a Visit to Ghuzni, Kabul, and Afghanistan, and of a Residence at the Court
Caste System in India
Evaluation of Educational Research
Studies in Women Writers in English
Mental Retardation and Social Responsibility
Migration and Migrants
Career Information and Guidance and Counselling
Diseases of Crop-Plants
Complete Book on Pregnancy and Child Birth
Modern Trends in Indian Education 2nd Revised and Enlarged Edition
Cricket The Essentials of the Game
History and Theory of Public Administration
War of Liberation in Bangladesh 1st Edition
Hillary Rodham Clinton: Polarizing First Lady (Modern First Ladies)
The Arthur of the English: The Arthurian Legend in English Life and Literature (University of Wales
On Loving Our Enemies Essays in Moral Psychology
The Laundry Man
The Rehearsal Pigeon Theatres Trilogy of Performance Works on Playing Dead
Historical Environmental Variation in Conservation and Natural Resource Management
The Intellectual and His People, Vol. 2 Staging the People
God Without Being Hors-Texte
A Cultural History of Heredity
The Rhyming Rabbit, 1
Perspectives of Hotel Management 1st Edition
2010 IEEE International Symposium on Precision Clock Synchronization for Measurement, Control and C
Islamic Food with Healing Touch
2010 IEEE 18th International Workshop on Quality of Service (IWQoS 2010) Proceedings of a Meeting h
Black Stars African American Women Scientists and Inventors
2010 3rd International Symposium on Systems and Control in Aeronautics and Astronautics (ISSCAA 201
13th International Conference on Aluminum Alloys ICAA 13
Management Text and Cases 2nd Edition
AIEEE Mathematics As Per New Pattern of Examinations
Covent Garden The Fruit, Vegetable and Flower Markets
Play Guitar With...Black Sabbath
Ecotoxicology and Environmental Health
The Handbook of Global Health Communication
Naxalism At a Glance
The Art of Mythical Composition and Narration Dagara White Bagr
Direct Taxes Ready Reckoner with Tax Planning For A.Y. 2012-2013 & 2013-2014
Charity and Philanthropy for Dummies
Dynamic Memory Modern Paragraph Writing : Secondary Level
Unspeakable Anecdotes My Life, Judiciary and More....
The Engineering Train
Tissue and Cell Clinical Use An Essential Guide
Contemporary Quilts: Design, Surface and Stitch
Encyclopaedia of Comparative Government and Select Constitutions 3 Vols.
Asymmetric Synthesis of Natural Products
History of Economic Thought
Household and Family Religion in Antiquity
The Rise of Kundalini A Practical Adviser
An Introduction to Distance Measurement in Astronomy
Japa and Dhyana in a Nutshell
Palliative and End of Life Care for Children and Young People Home, Hospice, Hospital
Improving Agricultural Education Concept and Methods
The Rise of Middle Classes in Manipur
Money and Banking in India
Organizational Behaviour and Design
Pentacles One Long Short Story and Four Long Story Poems in Free Verse
Writing Politics Left Discourses in Contemporary India 1st Reprint
Uttara-Kanda Vol. 4
Studies in Occultism 1st Indian Edition
Rgveda Hymns and Ancient Thought Vol. 1 1st Published
Punjab Today
Stories from Bhaagavatham 1st Edition
Understanding Communication Skills
Regulation of Financial Intermediaries in Emerging Markets
Productivity Techniques An Insight into Flow Manufacturing
Teacher Commitment
Test and Measurement in Education
Death Penalty
Teaching of Political Science
Role Multiplicity of Lower Middle Class Working Women
Environmental Degradation of Jammu and Kashmir Himalayas and their Control
Regional Movements, Ethnicity and Politics
Brahmasutram Srimadbrahmasutratadbhasyasahitayamtattvaprakasikayam
Encyclopaedic Dictionary of Biology
Environmental Issues and Challenges
Environment Protection and Development Emerging Issues, Reforms and Strategies
Old Maps and New Legacies of the Partition : A Pakistan Diary
Psycho-social Aspects of Sports
Teaching of Physical Science
History of Modern China and Japan (1840-1950)
Young Designers, 2002
A Text Book of Swasthavritta
Dictionary of New Words
Italian Renaissance Painting Colour Library
Classic Art An Introduction to the Italian Renaissance
Gothic Revival Art and Ideas
Monet Art and Ideas
Christian Boltanski
Van Gogh's Flowers
Emerging Religious Identities of Arunachal Pradesh A Study of Nyishi Tribe
Critical Theory Perspectives from Asia
History of Dalits
The Earl of Auckland And the First Afghan War
International Encyclopaedia of School Education
History of Journalism For PG Diploma and Degree Courses in Journalism and Mass Media
Empowering of Rural Workers Dynamics of Strategic Interventions, Experiments and Outcomes
Gender Dynamics in Water Security A Study in Rajasthan
Computer System Development
Documents
India and Her Neighbourhood A French Observer&am
Kirwant
Encyclopedia of Science Projects
Comparative Politics A Critique
Mensa Guide to Chess 30 Days to Great Chess
Research Methodology Modified Syllabus of Indian Universities/B.Ed. Training Institutes and College
Islam's Big no to Terrorism Friendship with All Malice for None
Medherb Green Pages : India and Pakistan - 2005 A Handbook of Authentic Updated Information on Indi
Assam-Medieval and Modem History
The Warrior and the Charioteer A Materialist Interpretation of the Bhagavadgita, Including a New Tra
Academic Library System
Nuclear Power and Non-Proliferation Conflict or Convergence?
Sriramacaritabdhiratna of Nityananda Shastri
The Strawberry
The Vakataka Heritage Indian Culture at the Crossroads
Pakistan Nation, Nationalism and the State
Administration and Training of Educational and Vocational Guidance
Dimensions of Social Research
British Reforms, Conquests and Expansion, 1807-1857
Pakistan's Foreign Policy
Stopped in Our Tracks Stories of U.G. in India
The Complete Technology Book on Pulp and Paper Industries
Academic Dictionary of Electronics
Academic Dictionary of Philosophy
Scientific Methods
Indian Political System Structures, Policy & Development
The Masnavi
An Essence of Biotechnology
Academic Dictionary of Science
Public Relations in India 1st Edition
Encyclopaedia of Geomorphology
Encyclopaedia of Social Problems and Social Welfare
The Laghusiddhanta Kaumudi Text with English Translation
Analysis of Great Philosophers
Panchatantram Aparikshitakarakam : According to CCIM Syllabus
Tarkabhasa of Srikesava Misra With the Commentary Prakasa of Govardhana
Space Woman Kalpana Chawla An Exclusive Biography of a Great Indian Woman Astronaut who Achieved Ra
Modern Encyclopaedia of Secondary Education
Impact of Internet on Journalism
Folk Tales of Manipur
Fundamentals of Political Sociology
Sustainable Agriculture Issues in Production, Management, Agronomy and ICT Applications
Sacred Tales of India
The Bureaucratic Ascendancy Public Administration in Bangladesh the First Three Decades
The Ramayana An Epic Play in Four Acts
Transformation Through the People, for the People
The Study of the Quran by Non-Muslim Indian Scholars
Writing Difference The Novels of Shashi Deshpande
A Lick of The Spoon Big Book New Edition
Another Cinema for Another Society
Media and Mediation
Muslim League in N.W.F.P
Hockey Skills and Rules
Riding the Nuclear Tiger
Applied Mechanics and Strength of Materials A Textbook for the Students of U.P.S.C. (Engg. Service)
Bangladesh The Next Afghanistan?
Art Today
Renzo Piano Building Workshop, Vol. 2
Van Gogh A&I
The Garden Book Mini Edition
Yes.. Mr. Finance Minister! How Indian Finance Ministers Missed Out on Unlocking the Nation&apos
Ambedkar Code of Conduct
Art of Dancing Classical and Folk Dances
Colonializing Agriculture They Myth of Punjab Exceptionalism
Management of Physical Education and Sports
Contemporary English Grammar for Scholars and Students
Comprehensive High School English Grammar and Composition
The Effective Presentation Talk Your Way to Success
Races of Afghanistan
Shaping Organisational Strategies Future Perspectives Concepts and Cases
Current Problems in World Higher Education
How to Coach Boxing
Teach Yourself Women Gymnastics
International Tourism Development
Foundation of Physical Education
Globalizing Democracy and Human Rights
Managing Safety Challenges Ahead Safety and Hazard Control
Mass with Children
Modern Methods of Teaching Language
Gardens of the Great Mughals Reprint London 1913 Edition
Supreme Court and High Court Judgements Relating to Women and Children
Poverty, Globalisation and Human Development
Fishery Management
Dimensions of Researches in Indian Anthropology
Typology and Universals
Jawahar Lal Nehru
Thoughts
Religion
Urban Centers of Pondicherry
World Famous Personalities Know the Great Minds of the World
The Cambridge Companion to English Renaissance Drama
Alex Katz Contemporary Artists
Francesca Woodman
Sempe Everything is Complicated
Julia Margaret Cameron
Wallpaper* City Guide Osaka (Wallpaper City Guides)
The Younger than Jesus Artist Directory
Noma Time and Place in Nordic Cuisine
Quick And Clever Felting
Irish Literature The Eighteenth Century
Discovering Psychology, Study Guide & Scientific American Reader for Hockenb
Galatea and Midas John Lyly
Physics of Semiconductors 29th International Conference on the Physics of Semiconductors
Microsoft SQL Server 2008 Internals (Pro - Developer)
Microsoft Outlook 2010 Inside Out
Coaching Youth Volleyball 4th Edition
Dazzling Dresses
Sarcosuchus Imperator (Discovering Dinosaurs)
Long Road to Freedom: Journey of the Hmong (High Five Reading)
Clara Barton Angel of the Battlefield
Martin Luther King, Jr. Great Civil Rights Leader
Beneath His Wings: Abiding in God's Comfort and Love
How to Study Your Bible for Kids (Discover 4 Yourself® Inductive Bible Studies for Kids)
Overcoming Fear and Discouragement: Ezra, Nehemiah, Esther (The New Inductive Study Series)
Grandma, Do You Remember When?: Sharing a Lifetime of Loving Memories--A Keepsake Journal
Discover the Bible for Yourself: *Helpful introductions to every book *Practical approaches for stu
Becoming the Woman of His Dreams: Seven Qualities Every Man Longs For
Loving God with All Your Mind Growth and Study Guide (Growth and Study Guides)
Breaking the Worry Habit...Forever!: Gods Plan for Lasting Peace of Mind
A Marriage Without Regrets: No matter where you are or where youve been, you can have
Finding the Right One for You: Secrets to Recognizing Your Perfect Mate
Where Grace Abides (The Riverhaven Years)
The Amazing Claims of Bible Prophecy: What You Need to Know in These Uncertain Times
Sassy, Single, and Satisfied: Secrets to Loving the Life Youre Living
You Can Do Tea
Quiet Time Moments for Women
Pollution (Writing the Critical Essay)
Bioisosteres in Medicinal Chemistry
Sia
Illustrated Classic Series Oliver Twist
Illustrated World Classics A Connecticut Yankee in King Arthur's Court
A+Manager DNA Decoded
Proton Exchange Membrane Fuel Cells Modeling
Love Destination Unknown
Time and her Little Sister
Career and Working on Cruise
Glimpses of Vedic Literature 1st Edition
Latest Shayari SMS
Menace of Crime in India Issues and Challenges
Problems and Solutions in Engineering Mathematics
Economic Liberalization Effects and Challenges 1st Edition
Sustainability and Economic Development in Hill Agriculture
Disaster Management and Economic Development
Sustainable Refurbishment
Environmental Hazards and Disasters Contexts, Perspectives and Management
Art and Architecture of Post-Gupta Period Central India
Handbook of Joint Disorders Arthroscopy and Pathology 1st Edition
Numerical Techniques in C
Learn Advanced HTML 4.0 with DHTML
Encyclopaedia of Plant Pathology
Theft of Brinjal
Optical Imaging and Metrology
United Nations (Opposing Viewpoints)
English Language Learners (Issues That Concern You)
The Loch Ness Monster (Monsters)
Mount Olive
Windows Server 2008 Administrator&a
Del Mar Fairgrounds
Lafayette (CA) (Images of America)
Indigenous Knowledge Traditions Perspective from North East India
Optical Materials in Defence Systems Technology IV
Guided Meditation
Flash Professional CS5 Training Guide
Imagining Alternatives
Clean Energy Option & Nuclear Safety An Indian Perspectives
Literary Journey of English Poetry Critical Analysis in Trends Style and Diction 2 Vols.
Practical Holography Includes Proceedings Vols. 0120, 1051, 1212, 1461, 1667, 1914, 2176, 2406, 2652
The Buffalo & the Monkey
Understanding Financial Market & Its Segregation
Modern Television Circuits Vol. 10
Spikes of Deep Silence by Silence and in Silence
The Goatherd and the Goats / Sour Grapes
Performance
Encyclopedia of World Religions 14. Vols
Fair Trade for All How Trade Can Promote Development
Decisions under Uncertainty Probabilistic Analysis for Engineering Decisions
Women's Health A Complete Guide
Snacks
Quality Management
Training Tact
My Own Khajuraho
Computer Dictionary
Sacred Bowl
Puzzle Pad 21
Puzzles Pad 22
Teaching of Social Science for the 21st Century
Assimilation of Remote Sensing and In Situ Data in Modern Numerical Weather and Environmental Predic
Fluctuations and Noise in Materials II
Modern Colour TV Circuits, Vol. XVIII 1st Edition
Book-4
Digest-5
F1 Get the Most out of Excel The Ultimate Excel Tip Help Guide for all Levels Excel 97, 2000, 2002,
Maharana Partap
Mughlai Dishes
Revisiting Indian Literature
Modern Speed Maths
Spatial Information Technology for Natural Resource Management
Media Literacy Project for Pre-University Students
The Bat / The Dog and the Thief
Freedom Movement in Rayalaseema A Study of Peoples Response to the Major Phases of National Movement
India's Policy Towards Sri Lanka Current Issues and Challenges
Best of Bible stories Old Testament
Smart Talk The Public Speakers Guide to Professional Success Unabridged Edition
Communication Skills for Hospitality Management Objective Type Questions and Answers
Simha the Lion
Super Fly Guy (Turtleback School & Library Binding Editi
Behold, Jesus is Coming: Revelation (New Inductive Study)
FTCE Math 6-12 (REA) - The Best Test Prep for the Florida Teacher Certification
Manara Erotic Tarot Mini [Boxed Deck - Mini]
Come Out and Play
Rainbow Pictorial Chart Book - Birds
List of MAK and BAT Values 2004 Maximum Concentrations and Biological Tolerance Values at the Workp
Sports Encyclopaedia
101 Science Projects
Cursive Writing-Book, Part 1
The Da Vinci Legacy
MS PowerPoint 2007
Power, Inc. The Epic Rivalry Between Big Business and Government- and the Reckoning That Lies Ahe
India Since Independence 2nd Edition
Sprinting for Fitness
UGC Net Exam-Library & Information Science (Multiple Choice Objective Type Quest
Sermons on Isaiah's Prophecy of the Death and Passion of Christ
Education of Children With Hearing Impairment
The Cost of Capital Intermediate Theory
The Pocket Oxford Greek Dictionary
Teaching and Assessing Skills in Computer Studies
Advanced Accounting C.A. (P.E. II) New Syllabus
Cities and Civilization
Organisational Design and Development
Adab AL-Qadi Islamic Legal and Judicial System
Etoa Munda Won the Battle A Story About Tribal Life 4th Reprint
Thimayya An Amazing Life
Law of Sale of Goods and Hire Purchase (Sale of Goods Act, 1930; Hire Purchase Act, 1972)
Advanced Cost and Management Accounting
Manual on Design of Towers for Long Span River Crossing
America on Record A History of Recorded Sound
The Quality Revolution Best Practice from the World's L
Total Quality Success Through People
Frontiers of Ocular Pharmacology and Therapeutics
Real Science What it is and What it Means
National Information System Planning and Management
Welding Processes and Technology 2nd Edition
Thinking the Right Way
Saints and Their Contribution in Classical Music
The Problem of Linguistic Universals
Microwave Engineering
The Cambridge Companion to Mendelssohn
An Ideal Personality
Building Science and Planning
Encyclopaedia of Bioinformatics
Basic Principles of Natural and Medical Sciences in Vedas and Puranas
Kids and Family Internet Guide
An Introduction to The Geomorphology of India
Computer-Aided Manufacturing In Accordance with U.P. Technical University Syllabus : A Degree Level
Engineering Chemistry A Textbook for First Year Engineering Students
Wavelets and Their Applications
Algorithms and Artificial Systems
Epidemiology and Culture
Vegetable Oils Sources and Enhancement Research in India
101 Great Indian Musicians and Dancers
Ancient Middle Niger Urbanism and the Self-organizing Landscape
Conservation
Introduction to the Mathematical and Statistical Foundations of Econometrics
Islam Its Politics and Spirituality
Crisis of Socialism Notes in Defence of a Commitment
Denial of Justice in International Law
Hatha Yoga for Human Health
The Films of Vincente Minnelli
Competition and Monopoly in the Federal Reserve System, 19141951 A Microeconomic Approach to Monet
Allama I.I. Kazi His Life and Thought
The Demography of Victorian England and Wales
Calculus of Finite Differences and Numerical Analysis (Allied Mathematics)
Secularism in India Theory and Practice
Dr. B.R. Ambedkar His Thoughts and Observations
From Marxism to Democratic Socialism The Deeper Roots of Affinity
Introductory Plant Virology For Graduate and Post Graduate Students of General Botany, Microbiology
NGOs in Livelihood Improvement Nepalese Experience
Dictionary of Power Systems and Electrical Engineering
Globalisation and Sustainable Agriculture
Methods of Educational Research
Waqai-i Manazil-i Rum Tipu Sultan's Mission to Constantinople
Monetary Economics
MCQs in Human Anatomy Reprint
Liberalisation, Globalisation and International Business
Encyclopedia of Plant Diseases in Agriculture and Horticulture
Supervision and Safety of Complex Systems
Chapter VII (Trpti Dipa Prakaranam) Vol. 3
The Arena Man
Junior Encyclopedia Human Body Question & Answers Book
The Edge 50 Tips from Brands that Lead
Retailing in India Emerging Trends
Prophet of Bones A Novel Unabridged Edition
Managing and Measuring Patients Satisfaction 1st Edition
UGC-NET Digest on Paper II & III Physical Education
Women's Social Rights and Entitlements
The Planting of Christianity in Africa, Vol. II : To 1840
The Avram Davidson Treasury A Tribute Collection
A Glimpse at the Back of the Book A Commentary on the Book of Revelation
Farmer Duck
Ocean Waves (A Quilting Mystery)
Field Guide to the Little People A Curious Journey Into the Hidden Realm of Elves, Faeries, Hobgobl
Letting the Light In Transforming Your Pain into Power
My Listography My Amazing Life in Lists
Stencil 101 Make Your Mark with 25 Reusable Stencils and Step-by-Step Instructions
Tequila: Myth, Magic &am
Life in Color Visual Therapy's Guide to the Perfect Palettefor Your Clo
In My Nest Finger Puppet Book
Porch Parties Cocktail Recipes & Easy Ideas for Outdoor Entertaining
Fresh from the Farmers Market (Reissue): Year-Round Recipes for the Pick of the Crop
Farts A Spotter's Guide
The Doorbells of Florence Fictional Stories and Photographs
The Country Cooking of Ireland
Polk County, Georgia (GA) (Images of America)
Design Research: The Store That Brought Modern Living to American Homes
Bound to Be Bad (Ivy and Bean, Book 5)
New York City Subway
Talking to Tweens: Getting It Right Before It Gets Rocky with Your 8- to 12-Year-Old
Chocolate Cakes 50 Great Cakes for Every Occasion
Young Guns 6 and the Undiscovered Letter Vol. 1
Fuck You and Your Blog Journal
Philadelphia Graveyards and Cemeteries (Images of America: Pennsylvania)
Kitchen Sticky Notes Helpful Notes for the Home Cook
The Little Books Boxed Set
Mini Locker Notes
1,001 Ways to Live in the Moment
Eat Ate
Scribble It! 30 Postcards
Cupcake Shoppe Stationery
Moma Modern Play Family
Let's Bring Back...
A Long Piece of String
Stories for Bedtime A Keepsake Pocket and Tales to Cherish
You Can Do It Too!
In My Forest
The Worst-Case Scenario Survival Handbook Gross Junior Edition
Giant Pop-Out Safari A Pop-Out Surprise Book
Touch (The Five Senses)
Language in the Inner City: Studies in the Black English Vernacular (Conduct and Communication)
Daily Life in the World of Charlemagne (Middle Ages)
Everyday Life in Egypt in the Days of Ramesses The Great
The Spoken Word and the Work of Interpretation (Conduct and Communication)
History Begins at Sumer Thirty-Nine Firsts in Recorded History 3rd Edition
Enterprising Women Television Fandom and the Creation of Popular Myth
Dangerous Men and Adventurous Women Romance Writers on the Appeal of the Romance
Before Columbus Exploration and Colonization from the Mediterranean to the Atlantic, 1229-1492
Aquinas and the Jews
Beyond the Red Notebook: Essays on Paul Auster (Penn Studies in Contemporary American Fiction)
The Heartland Chronicles
Indian Literature in English Translation
Phycology-Nature and Nuriture
History of Journalism
Jammu and Kashmir Charting a Future
Defence Policy of India [Nehru to Manmohan]
Birds of Himalaya and Kashmir
Strategies for Performance Management
Street Children and the Child Labour
Problems of Slums and Viable Strategies for Development
Social Cognition and Communalism
Introductory Quantum Mechanics and Spectroscopy
Dynamics of Creativity and Interests Engineers Verses Civil Servants
Solution to Problems Financial Accounting, HP
Economics of Asymmetric Information
Modern Women and the Society
Management of Health Education Programme
Camping Management in Physical Education
Record of Yoga
Language in Contemporary India
UGC (NET) Manual for Library and Information Science Paper II Objective Questions and Paper III : D
Vitality of East Asian Christianity Challenges to Mission and Theology in Japan
DDC 22 A Practical Approach
Concept of Suffering in Buddhism 1st Published
Citriculture
Introduction to Operating System
Elementary Income Tax AP
Education on Internet Programming
Introduction to Chemical Equipment Design Mechanical Aspects
Environment and Pollution Education
Human Resource Development Theory and Practice
Epicentre of Violence Partition Voices and Memories from Amritsar
Rasa-Jala-Nidhi or Ocean of Indian Chemistry and Alchemy With English Translation


Sitemap Popular Random Top
000webhost logo